UniGene Name: sp_v3.0_unigene75567
Length: 181 nt
UniGene Fasta |
---|
>sp_v3.0_unigene75567
G |
Ace file of the UniGene sp_v3.0_unigene75567 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Ribulose-phosphate 3-epimerase, chloroplastic n=7 Tax=Poaceae RepID=RPE_ORYSJ | - | - | 4.0e-23 | 88% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
Sma3 | Ribulose-phosphate 3-epimerase | - | - | 9.315e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribulose-phosphate 3-epimerase. | EC:5.1.3.1 | - | 6.557e-18 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pentose phosphate pathway | 00030 | 6.557e-18 | % | |
Sma3 | Pentose and glucuronate interconversions | 00040 | 6.557e-18 | % | |
Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 6.557e-18 | % | |
Sma3 | Metabolic pathways | 01100 | 6.557e-18 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 6.557e-18 | % |
Source | Gene names |
---|---|
Sma3 | AT5G61410; At5g61410; CHLREDRAFT_135614; GSVIVT00016307001; LOC_Os03g07300; MICPUCDRAFT_47473; MICPUN_104768; OSTLU_32100; Os03g0169100; OsI_10180; OsJ_09567; Ot06g01840; PHYPADRAFT_111326; PHYPADRAFT_122169; PHYPADRAFT_207297; POPTRDRAFT_744163; RCOM_147 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | ribulose-phosphate 3-epimerase activity | GO:0004750 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
Sma3 | tRNA wobble uridine modification | GO:0002098 | Biological Process | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | pentose-phosphate shunt | GO:0006098 | Biological Process | 0.0 | - |
Sma3 | reductive pentose-phosphate cycle | GO:0019253 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribulose-phosphate 3-epimerase | IPR000056 | - | 0.0 | - |
Sma3 | Glucose-inhibited division protein A-related | IPR002218 | - | 0.0 | - |
Sma3 | Glucose-inhibited division protein A | IPR004416 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G61410.1 | RPE, EMB2728 D-ribulose-5-phosphate-3-epimerase chr5:24684085-24685836 REVERSE LENGTH=281 | 3.0e-30 | 86% |
RefSeq | Arabidopsis thaliana | NP_200949.1 | D-ribulose-5-phosphate-3-epimerase [Arabidopsis thaliana] | 3.0e-30 | 86% |
RefSeq | Populus trichocarpa | XP_002330128.1 | predicted protein [Populus trichocarpa] | 6.0e-30 | 85% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NP17
Fln msg: Distance to subject end: 129 aas, your sequence is shorter than subject: 60 - 292
Fln protein:
D
Protein Length:
61
Fln nts:
G
Fln Alignment:
GFIJCBT03G7KIU___DGRFVPNITIGPLVVDALRPLTDAPLDTHLMIVEPEQRVADFIKAGSDIVSVHAEQSSTV
A9NP17_______________DGRFVPNITIGPLVVAALRPVTDLPLDVHLMIVEPDQRVPDFIKAGADIVSVHCEQSSTI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain