UniGene Name: sp_v3.0_unigene75550
Length: 172 nt
![]() |
---|
>sp_v3.0_unigene75550
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Phenylpropenal double-bond reductase n=1 Tax=Pinus taeda RepID=Q0PIN2_PINTA | - | - | 4.0e-15 | 87% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 95% |
Sma3 | Quinone oxidoreductase-like protein | - | - | 6.757e-19 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 4.293e-15 | - |
Source | Gene names |
---|---|
Sma3 | ADH3; ALH; At1g26320; At3g03080; At3g59840; At3g59845; At5g16960; At5g16970; At5g16980; At5g16980/F2K13_130; At5g16990; At5g17000; At5g37940; At5g37980; At5g38000; B1078G07.5; Dbr1; F24G16.110; F28B23.3; F2K13_110; F2K13_120; F2K13_130; F2K13_140; F5I14.9 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | 2-alkenal reductase [NAD(P)] activity | GO:0032440 | Molecular Function | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G26320.1 | Zinc-binding dehydrogenase family protein chr1:9105240-9107029 FORWARD LENGTH=351 | 3.0e-18 | 70% |
RefSeq | Arabidopsis thaliana | NP_173956.1 | 2-alkenal reductase [Arabidopsis thaliana] | 5.0e-18 | 70% |
RefSeq | Populus trichocarpa | XP_002331649.1 | predicted protein [Populus trichocarpa] | 4.0e-19 | 75% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0J4
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 110 aas, your sequence is shorter than subject: 57 - 350
Fln protein:
R
Protein Length:
58
Fln nts:
A
Fln Alignment:
GFIJCBT03GDNLV___QVKLLKEEFGFDDAFNYKSETDWDAALTRHFPRGIDIYFDNVGGRML
A9P0J4_______________KVKLLKEEFGFDDAFNYRSETDWDAALTRHFPRGIDIYFDNVGGRML
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain