|
||||||
|
UniGene Name: sp_v3.0_unigene75459
Length: 215 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene75459
T |
|
Ace file of the UniGene sp_v3.0_unigene75459
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Os01g0689900 protein n=3 Tax=Oryza sativa Japonica Group RepID=Q5N7Q8_ORYSJ | - | - | 5.0e-15 | 80% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 55% |
| Sma3 | Wall-associated kinase, putative | - | - | 2.706e-20 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 2.667e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G79620; AT4g39110; AT5G49760; At1g18390; At1g25390; At1g66880; At1g79620; At1g79620/F20B17_5; At2g21480; At2g23450; At2g29000; At3g46290; At3g53840; At4g39110; At5g38210; At5g49760; At5g49760/K2I5_13; At5g59700; At5g61350; F12M12.260; F15H18.11; F15H18 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | peptidyl-prolyl cis-trans isomerase activity | GO:0003755 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G18390.2 | - | 2.0e-15 | 79% |
| RefSeq | Arabidopsis thaliana | NP_173275.4 | protein kinase domain-containing protein [Arabidopsis thaliana] | 2.0e-15 | 79% |
| RefSeq | Populus trichocarpa | XP_002337962.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-17 | 81% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWR4
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 186 aas, your sequence is shorter than subject: 71 - 402
Fln protein:
*
Protein Length:
72
Fln nts:
T
Fln Alignment:
GFIJCBT03GSTJX___LEPPIIHRDVKSPNILLDEDLHVKVADFGLSRFVPFDVTHVSTAPQG
A9NWR4_______________LVPHIVHRDIKASNVLLDRDLNPKIADFGLAKLFPDNVTHISTRVAG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
