UniGene Name: sp_v3.0_unigene75454
Length: 158 nt
![]() |
---|
>sp_v3.0_unigene75454
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | 26S proteasome regulatory complex, ATPase RPT4 n=3 Tax=Agaricales RepID=B0CU44_LACBS | - | - | 2.0e-20 | 96% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 80% |
Sma3 | Proteasomal ATPase | - | - | 2.463e-13 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Microtubule-severing ATPase. | EC:3.6.4.3 | - | 6.883e-20 | - |
Source | Gene names |
---|---|
Sma3 | AT3G09840; AT4g29040; At1g09100; At1g45000; At1g45000/F27F5.8; At1g53750; At2g20140; At3g05530; At3g05530/F22F7.1; At3g09840; At3g53230; At4g29040; At5g03340; At5g19990; At5g20000; At5g43010; At5g58290; AtSUG1; BrTBP; CAFP; CDC48; CDC48A; CDC48D; CDC48E; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | cytoskeleton | GO:0005856 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | flagellum | GO:0019861 | Cellular Component | 0.0 | - |
Sma3 | protein complex | GO:0043234 | Cellular Component | 0.0 | - |
Sma3 | ATP-dependent peptidase activity | GO:0004176 | Molecular Function | 0.0 | - |
Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | peptidase activity | GO:0008233 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, uncoupled | GO:0042624 | Molecular Function | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | intracellular protein transport | GO:0006886 | Biological Process | 0.0 | - |
Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
Sma3 | protein catabolic process | GO:0030163 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | NSF attachment protein | IPR000744 | - | 0.0 | - |
Sma3 | Chaperonin ClpA/B | IPR001270 | - | 0.0 | - |
Sma3 | IPR001984 | - | 0.0 | - | |
Sma3 | CDC48, N-terminal subdomain | IPR003338 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, conserved site | IPR003960 | - | 0.0 | - |
Sma3 | CDC48, domain 2 | IPR004201 | - | 0.0 | - |
Sma3 | 26S proteasome subunit P45 | IPR005937 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, CDC48 | IPR005938 | - | 0.0 | - |
Sma3 | Aspartate decarboxylase-like fold | IPR009010 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Vps4 oligomerisation, C-terminal | IPR015415 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G43010.1 | RPT4A regulatory particle triple-A ATPase 4A chr5:17248563-17251014 REVERSE LENGTH=399 | 2.0e-24 | 82% |
RefSeq | Arabidopsis thaliana | NP_001117440.1 | AAA-type ATPase family protein [Arabidopsis thaliana] | 1.0e-24 | 82% |
RefSeq | Populus trichocarpa | XP_002313775.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-24 | 82% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLX8
Fln msg: Distance to subject end: 201 aas, your sequence is shorter than subject: 52 - 398
Fln protein:
E
Protein Length:
53
Fln nts:
G
Fln Alignment:
GFIJCBT03GNRLS___EQVRELREVIELPLLSPELFLRVGIKPPKGVLLYGPPGTGKTLLARAVAATL
B8LLX8_______________DQIRELRESIELPLMNPELFIRVGIKPPKGVLLYGPPGTGKTLLARAIASNI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain