UniGene Name: sp_v3.0_unigene75445
Length: 207 nt
![]() |
---|
>sp_v3.0_unigene75445
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Tubulin gamma chain n=1 Tax=Sclerotinia sclerotiorum 1980 UF-70 RepID=A7E6H2_SCLS1 | - | - | 5.0e-18 | 85% |
FL-Next | sp=Tubulin gamma chain; Chlamydomonas reinhardtii (Chlamydomonas smithii). | - | - | 0.0 | 73% |
Sma3 | Gamma-tubulin | - | - | 1.771e-19 | - |
Source | Gene names |
---|---|
Sma3 | CHLREDRAFT_188933; GSVIVT00026983001; MICPUCDRAFT_27658; MICPUN_84777; Os05g0156600; OsI_18532; OsJ_17184; PHYPADRAFT_170153; PHYPADRAFT_170860; POPTRDRAFT_572355; POPTRDRAFT_755367; RCOM_0149720; TBG1; THAPSDRAFT_29237; TUB4; TUBC; TUBG; TUBG1; TUBG2; TU |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | microtubule | GO:0005874 | Cellular Component | 0.0 | - |
Sma3 | protein complex | GO:0043234 | Cellular Component | 0.0 | - |
Sma3 | GTPase activity | GO:0003924 | Molecular Function | 0.0 | - |
Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
Sma3 | microtubule-based process | GO:0007017 | Biological Process | 0.0 | - |
Sma3 | protein polymerization | GO:0051258 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Tubulin | IPR000217 | - | 0.0 | - |
Sma3 | Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain | IPR001327 | - | 0.0 | - |
Sma3 | Gamma tubulin | IPR002454 | - | 0.0 | - |
Sma3 | Tubulin/FtsZ, GTPase domain | IPR003008 | - | 0.0 | - |
Sma3 | Pyridine nucleotide-disulphide oxidoreductase, dimerisation | IPR004099 | - | 0.0 | - |
Sma3 | Dihydrolipoamide dehydrogenase | IPR006258 | - | 0.0 | - |
Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class I, active site | IPR012999 | - | 0.0 | - |
Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
Sma3 | Tubulin, conserved site | IPR017975 | - | 0.0 | - |
Sma3 | Tubulin/FtsZ, 2-layer sandwich domain | IPR018316 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G05620.1 | TUBG2, ATGCP2, GCP2 gamma-tubulin complex protein 2 chr5:1679340-1681719 FORWARD LENGTH=474 | 1.0e-17 | 71% |
RefSeq | Arabidopsis thaliana | NP_196181.1 | tubulin gamma-2 chain [Arabidopsis thaliana] | 2.0e-17 | 71% |
RefSeq | Populus trichocarpa | XP_002320847.1 | tubulin gamma-1 chain, at3g61650-like protein [Populus trichocarpa] | 1.0e-16 | 69% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q39582
Fln msg: Distance to subject end: 62 aas, your sequence is shorter than subject: 68 - 468
Fln protein:
V
Protein Length:
69
Fln nts:
A
Fln Alignment:
GFIJCBT03HJ7AR___VHKSLLRIRERQLARFIPWGAASIQVALAKKSPYSPSNHRVSGLTLANHTGI
Q39582_______________VHKSLQRIRERKQANFIEWGPASIQVALSKKSPYVQTAHRVSGLMLANHTSV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain