UniGene Name: sp_v3.0_unigene75405
Length: 153 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene75405
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative protein kinase; 29119-30743 [Arabidopsis thaliana] | - | - | 8.0e-12 | 68% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
Sma3 | Leucine-rich repeat receptor-like protein kinase | - | - | 7.406e-09 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 2.963e-11 | - |
Source | Gene names |
---|---|
Sma3 | AT1G07650; AT1G29750; AT1G53420; AT1G53430; AT1G53440; AT3G14840; At1g29730; At1g29750; B1153E06.9; F1N18.19; F1N18.20; F1N18.21; F24B9.29; F5A18.8; GSVIVT00002762001; GSVIVT00017705001; GSVIVT00018818001; GSVIVT00020696001; GSVIVT00021495001; GSVIVT00023 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | metal ion transmembrane transporter activity | GO:0046873 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | cell wall macromolecule catabolic process | GO:0016998 | Biological Process | 0.0 | - |
Sma3 | metal ion transport | GO:0030001 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G70740.1 | Protein kinase superfamily protein chr1:26673847-26675687 REVERSE LENGTH=425 | 1.0e-16 | 68% |
RefSeq | Arabidopsis thaliana | NP_001185366.1 | protein kinase domain-containing protein [Arabidopsis thaliana] | 2.0e-16 | 68% |
RefSeq | Populus trichocarpa | XP_002315871.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-18 | 68% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NQB9
Fln msg: Distance to subject end: 135 aas, your sequence is shorter than subject: 51 - 290
Fln protein:
V
Protein Length:
52
Fln nts:
G
Fln Alignment:
GFIJCBT03F03QG___VSKALPEDETHIQTRVAGTYGYMAPEYAMRGQLSVKVDVYSFGVLVLEIVS
A9NQB9_______________LARLFPDDETHVHTRVAGTYGYMAPEYAMLGQLSVKADVYSFGVVLLEIVS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain