UniGene Name: sp_v3.0_unigene75364
Length: 160 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene75364
G |
Ace file of the UniGene sp_v3.0_unigene75364
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Type I inositol polyphosphate 5-phosphatase, putative n=1 Tax=Ricinus communis RepID=B9S378_RICCO | - | - | 9.0e-18 | 75% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 39% |
| Sma3 | Type I inositol-1,4,5-trisphosphate 5-phosphatase CVP2 | - | - | 6.024e-15 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Inositol-polyphosphate 5-phosphatase. | EC:3.1.3.56 | - | 6.269e-10 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Inositol phosphate metabolism | 00562 | 6.269e-10 | % | |
| Sma3 | Metabolic pathways | 01100 | 6.269e-10 | % | |
| Sma3 | Phosphatidylinositol signaling system | 04070 | 6.269e-10 | % |
| Source | Gene names |
|---|---|
| Sma3 | 5PT3; At1g05470; At2g32010; At3g63240; At3g63240/F16M2_90; At5g04980; At5g65090; CVP2; F16M2_90; GSVIVT00002655001; GSVIVT00023759001; LOC_Os03g06460; LOC_Os03g13520; LOC_Os03g57950; LOC_Os10g28660; OJ1119_H02.13; OJ1654_B10.1; OSJNBa0034D21.13; OSJNBb004 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | inositol or phosphatidylinositol phosphatase activity | GO:0004437 | Molecular Function | 0.0 | - |
| Sma3 | inositol-polyphosphate 5-phosphatase activity | GO:0004445 | Molecular Function | 0.0 | - |
| Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
| Sma3 | procambium histogenesis | GO:0010067 | Biological Process | 0.0 | - |
| Sma3 | leaf vascular tissue pattern formation | GO:0010305 | Biological Process | 0.0 | - |
| Sma3 | cotyledon vascular tissue pattern formation | GO:0010588 | Biological Process | 0.0 | - |
| Sma3 | cell differentiation | GO:0030154 | Biological Process | 0.0 | - |
| Sma3 | inositol trisphosphate metabolic process | GO:0032957 | Biological Process | 0.0 | - |
| Sma3 | inositol phosphate dephosphorylation | GO:0046855 | Biological Process | 0.0 | - |
| Sma3 | inositol phosphate-mediated signaling | GO:0048016 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Inositol polyphosphate-related phosphatase | IPR000300 | - | 0.0 | - |
| Sma3 | Phosphoglycerate/bisphosphoglycerate mutase, active site | IPR001345 | - | 0.0 | - |
| Sma3 | YLP motif | IPR004019 | - | 0.0 | - |
| Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
| Sma3 | Phosphoglycerate mutase 1 | IPR005952 | - | 0.0 | - |
| Sma3 | Histidine phosphatase superfamily, clade-1 | IPR013078 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G04980.2 | DNAse I-like superfamily protein chr5:1468575-1470684 REVERSE LENGTH=466 | 2.0e-21 | 69% |
| RefSeq | Arabidopsis thaliana | NP_196117.2 | endonuclease/exonuclease/phosphatase domain-containing protein [Arabidopsis thaliana] | 2.0e-21 | 69% |
| RefSeq | Populus trichocarpa | XP_002310959.1 | predicted protein [Populus trichocarpa] | 2.0e-21 | 69% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADM7
Fln msg: Distance to subject end: 138 aas, your sequence is shorter than subject: 53 - 462
Fln protein:
E
Protein Length:
54
Fln nts:
G
Fln Alignment:
GFIJCBT03G68CE___EHDRVIWLGDLNYRIA-LCYSYTKQLVERNDWEALLESDQLRIEHEAGRVFRG
D5ADM7_______________EADMLIWFGDFNYRLDDISYDEARNYIACKHFDTILRKDQLRGEMKAGHVFQG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta