UniGene Name: sp_v3.0_unigene75336
Length: 210 nt
UniGene Fasta |
---|
>sp_v3.0_unigene75336
A |
Ace file of the UniGene sp_v3.0_unigene75336 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | CBL-interacting protein kinase 02 n=2 Tax=Selaginella moellendorffii RepID=C4P7R4_SELML | - | - | 4.0e-16 | 64% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
Sma3 | CBL-interacting serine/threonine-protein kinase, putative | - | - | 9.095e-15 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 6.678e-10 | - |
Sma3 | Calcium/calmodulin-dependent protein kinase. | EC:2.7.11.17 | - | 1.109e-11 | - |
Source | Gene names |
---|---|
Sma3 | ATC401; At1g30270; At2g26980; At5g21222; At5g21326; CIPK1; CIPK12; CIPK13; CIPK23; CIPK24; CIPK25; CIPK26; CIPK3; CIPK31; CIPK32; CIPK33; CIPK4; CK1; F12P21.6; F13M11; GSVIVT00017348001; GSVIVT00019722001; GSVIVT00026148001; GSVIVT00028341001; LKS1; LOC_O |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | potassium channel activity | GO:0005267 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
Sma3 | potassium ion binding | GO:0030955 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | response to nutrient | GO:0007584 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | response to abiotic stimulus | GO:0009628 | Biological Process | 0.0 | - |
Sma3 | response to cytokinin stimulus | GO:0009735 | Biological Process | 0.0 | - |
Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
Sma3 | potassium ion import | GO:0010107 | Biological Process | 0.0 | - |
Sma3 | stomatal movement | GO:0010118 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | NAF domain | IPR004041 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | NAF/FISL domain | IPR018451 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G21222.1 | protein kinase family protein chr5:7209422-7213700 FORWARD LENGTH=831 | 4.0e-20 | 66% |
RefSeq | Arabidopsis thaliana | NP_850859.2 | SNF1-like protein kinase [Arabidopsis thaliana] | 5.0e-20 | 66% |
RefSeq | Populus trichocarpa | XP_002330980.1 | predicted protein [Populus trichocarpa] | 2.0e-21 | 62% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQ83
Fln msg: Distance to subject end: 153 aas, your sequence is shorter than subject: 70 - 387
Fln protein:
T
Protein Length:
71
Fln nts:
A
Fln Alignment:
GFIJCBT03F8QX6___TNLAVLYYKISKSDFKCPKWLSVGACNLIKRILDPNRKTRITIPEIMEDEWFKQGYSPAK-SVEEDTYLD
B8LQ83_______________SNLMTLYKKIYKADFTCPSWFSSSAKKLITRILDPNPKTRITIPEILDNEWFKKGYKPPKFNEEEDVNLD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain