UniGene Name: sp_v3.0_unigene75312
Length: 167 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene75312
T |
Ace file of the UniGene sp_v3.0_unigene75312 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9LNU6.2|PPR53_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g20230 gb|AEE29953.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | - | - | 3.0e-14 | 66% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 66% |
| Source | Gene names |
|---|---|
| Sma3 | At1g20230; At2g01510; At2g36730; At4g02750; At4g16835; At4g21300; At4g22765; At5g08510; At5g59600; B1032F05.19; DYW10; F13K3.13; F2I9.13; F2O15.13; F8L15.21; FCAALL.441; GSVIVT00002068001; GSVIVT00002920001; GSVIVT00006973001; GSVIVT00008660001; GSVIVT000 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | diacylglycerol kinase activity | GO:0004143 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway | GO:0007205 | Biological Process | 0.0 | - |
| Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribonuclease P | IPR000100 | - | 0.0 | - |
| Sma3 | Oligopeptide transporter | IPR000109 | - | 0.0 | - |
| Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
| Sma3 | Diacylglycerol kinase, accessory domain | IPR000756 | - | 0.0 | - |
| Sma3 | Diacylglycerol kinase, catalytic domain | IPR001206 | - | 0.0 | - |
| Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
| Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G20230.1 | Pentatricopeptide repeat (PPR) superfamily protein chr1:7009570-7011852 FORWARD LENGTH=760 | 4.0e-19 | 66% |
| RefSeq | Arabidopsis thaliana | NP_173449.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 6.0e-19 | 66% |
| RefSeq | Populus trichocarpa | XP_002311156.1 | predicted protein [Populus trichocarpa] | 7.0e-20 | 67% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0W0
Fln msg: Distance to subject end: 194 aas, your sequence is shorter than subject: 55 - 370
Fln protein:
F
Protein Length:
56
Fln nts:
T
Fln Alignment:
GFIJCBT03G93GH___FDSMSRDHCIAPKVQHYACMVDLLGRAGCLNEAYDLIKKMPFDPDAAVWGALL
A9P0W0_______________FDSMTRDHGISPKAEHYSCMVDLFGRAGCLDEALNFINQMPVEPNASVWGSLL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)