UniGene Name: sp_v3.0_unigene75254
Length: 227 nt
UniGene Fasta |
---|
>sp_v3.0_unigene75254
G |
Ace file of the UniGene sp_v3.0_unigene75254 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | R2R3-MYB transcription factor MYB4 n=1 Tax=Picea glauca RepID=A5JYE8_PICGL | - | - | 2.0e-19 | 77% |
FL-Next | tr=R2R3-MYB transcription factor MYB4; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 77% |
Sma3 | MYB transcription factor | - | - | 4.829e-28 | - |
Source | Gene names |
---|---|
Sma3 | 117M18_17; AT4g22680; At1g09540; At1g16490; At1g34670; At1g57557; At1g57560; At1g63910; At3g02940; At3g08500; At3g12720; At3g13890; At4g01680; At4g01680/T15B16.4; At4g12350; At4g21440; At4g22680; At4g34990; At5g10280; At5g12870; At5g14340; At5g16770; At5g |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | specific transcriptional repressor activity | GO:0016566 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | response to UV | GO:0009411 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | phenylpropanoid biosynthetic process | GO:0009699 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | secondary cell wall biogenesis | GO:0009834 | Biological Process | 0.0 | - |
Sma3 | trichome morphogenesis | GO:0010090 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | tapetal layer development | GO:0048658 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Inositol monophosphatase | IPR000760 | - | 0.0 | - |
Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | IPR014778 | - | 0.0 | - | |
Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G12870.1 | ATMYB46, MYB46 myb domain protein 46 chr5:4062939-4064939 REVERSE LENGTH=280 | 3.0e-23 | 74% |
RefSeq | Arabidopsis thaliana | NP_196791.1 | transcription factor MYB46 [Arabidopsis thaliana] | 4.0e-23 | 74% |
RefSeq | Populus trichocarpa | XP_002313334.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-24 | 70% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A5JYE8
Fln msg: Distance to subject end: 233 aas, your sequence is shorter than subject: 75 - 334
Fln protein:
D
Protein Length:
76
Fln nts:
G
Fln Alignment:
GFIJCBT03GJPVS___DSKLINYILKNGLDDSWTYVSKQAGLQRCGKSCRLRWVNYLRPDLKRGAFSSQEERLI
A5JYE8_______________DDKLINYMMKNG-QGCWSDVAKQAGLQRCGKSCRLRWINYLRPDLKRGAFSPQEEQLI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain