UniGene Name: sp_v3.0_unigene75220
Length: 244 nt
UniGene Fasta |
---|
>sp_v3.0_unigene75220
T |
Ace file of the UniGene sp_v3.0_unigene75220 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pattern formation protein, putative n=1 Tax=Ricinus communis RepID=B9SVJ6_RICCO | - | - | 3.0e-23 | 87% |
FL-Next | sp=Pattern formation protein EMB30; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 80% |
Sma3 | Pattern formation protein, putative | - | - | 4.064e-12 | - |
Source | Gene names |
---|---|
Sma3 | At1g13980; At5g19610; At5g39500; EMB30; F16A14.20; F7A19.7; GEP1; GNOM; GSVIVT00015712001; GSVIVT00016764001; H0207B04.10; LOC_Os03g46330; OSJNBa0056E06.17; OSJNBb0042G06.4; OSJNBb0050O03.11; Os02g0326600; Os03g0666100; OsI_07009; OsI_12908; OsI_14634; Os |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | ARF guanyl-nucleotide exchange factor activity | GO:0005086 | Molecular Function | 0.0 | - |
Sma3 | GTP:GDP antiporter activity | GO:0010292 | Molecular Function | 0.0 | - |
Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
Sma3 | cytokinesis by cell plate formation | GO:0000911 | Biological Process | 0.0 | - |
Sma3 | establishment of planar polarity | GO:0001736 | Biological Process | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | cell adhesion | GO:0007155 | Biological Process | 0.0 | - |
Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
Sma3 | embryonic pattern specification | GO:0009880 | Biological Process | 0.0 | - |
Sma3 | longitudinal axis specification | GO:0009942 | Biological Process | 0.0 | - |
Sma3 | phloem or xylem histogenesis | GO:0010087 | Biological Process | 0.0 | - |
Sma3 | lateral root primordium development | GO:0010386 | Biological Process | 0.0 | - |
Sma3 | basipetal auxin transport | GO:0010540 | Biological Process | 0.0 | - |
Sma3 | regulation of ARF protein signal transduction | GO:0032012 | Biological Process | 0.0 | - |
Sma3 | regulation of vesicle targeting, to, from or within Golgi | GO:0048209 | Biological Process | 0.0 | - |
Sma3 | root hair cell differentiation | GO:0048765 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
Sma3 | SEC7-like | IPR000904 | - | 0.0 | - |
Sma3 | Protease-associated domain, PA | IPR003137 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Proteinase inhibitor I9 | IPR010259 | - | 0.0 | - |
Sma3 | Peptidase S8, subtilisin-related | IPR015500 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G13980.1 | GN, VAN7, EMB30 sec7 domain-containing protein chr1:4789587-4794397 FORWARD LENGTH=1451 | 5.0e-25 | 80% |
RefSeq | Arabidopsis thaliana | NP_001184991.1 | Pattern formation protein EMB30 [Arabidopsis thaliana] | 6.0e-25 | 80% |
RefSeq | Populus trichocarpa | XP_002324976.1 | predicted protein [Populus trichocarpa] | 1.0e-18 | 65% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q42510
Fln msg: ERROR#3, very serious frame error, Overlapping hits, possible frame ERROR between 166 and 166, Distance to subject end: 737 aas, your sequence is shorter than subject: 81 - 1451
Fln protein:
A
Protein Length:
82
Fln nts:
T
Fln Alignment:
GFIJCBT03GSJWN___YIHVNTALRTFLETFRLPGESQKIQRVMEAFAERYYEQSPQILADKDAALVLAYSLILLNTDQHNAQVKRKMTEDD
Q42510_______________YMNLDTALRLFLETFRLPGESQKIQRVLEAFSERYYMQSPEILANKDAALVLSYSIIMLNTDQHNVQVKKKMTEED
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain