UniGene Name: sp_v3.0_unigene75095
Length: 243 nt
UniGene Fasta |
---|
>sp_v3.0_unigene75095
T |
Ace file of the UniGene sp_v3.0_unigene75095 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pfam00722, Glyco_hydro_16, Glycosyl hydrolases family 16 | - | - | 1.0e-18 | 43% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
Source | Gene names |
---|---|
Sma3 | GSVIVT00011620001; GSVIVT00012496001; VITISV_032683; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | xyloglucan:xyloglucosyl transferase activity | GO:0016762 | Molecular Function | 0.0 | - |
Sma3 | cellular glucan metabolic process | GO:0006073 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycoside hydrolase, family 16 | IPR000757 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 16, active site | IPR008263 | - | 0.0 | - |
Sma3 | Beta-glucanase | IPR008264 | - | 0.0 | - |
Sma3 | Xyloglucan endo-transglycosylase, C-terminal | IPR010713 | - | 0.0 | - |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
Sma3 | Xyloglucan endotransglucosylase/hydrolase | IPR016455 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G13870.1 | EXGT-A4, XTH5 xyloglucan endotransglucosylase/hydrolase 5 chr5:4475089-4476217 REVERSE LENGTH=293 | 3.0e-21 | 53% |
RefSeq | Arabidopsis thaliana | NP_196891.1 | xyloglucan:xyloglucosyl transferase [Arabidopsis thaliana] | 4.0e-21 | 53% |
RefSeq | Populus trichocarpa | XP_002306736.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-22 | 49% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NQP4
Fln msg: Overlapping hits, possible frame ERROR between 64 and 51, Distance to subject end: 84 aas, your sequence is shorter than subject: 81 - 293
Fln protein:
A
Protein Length:
82
Fln nts:
T
Fln Alignment:
GFIJCBT03GI413___ASGVGNREQRFHLWFDxxxxxNNYTLIWNHKQIVFWVDSIPIRAFKNNEEAVGVPYPNSRPMRIITSLWNGEDWATDGGR
A9NQP4_______________ANGVGNREQKIRLWFDxxxxxHNYSIIWNHKQIVFWVDSIPIRAFKNNEETAGVPYPNRRSMRIISTLWNGEDWATDGGR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain