UniGene Name: sp_v3.0_unigene75080
Length: 130 nt
![]() |
---|
>sp_v3.0_unigene75080
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative ribosomal protein S3 n=1 Tax=Mayetiola destructor RepID=D1MLN7_MAYDE | - | - | 9.0e-16 | 100% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 79% |
Sma3 | 40S ribosomal protein S3, putative | - | - | 1.882e-08 | - |
Source | Gene names |
---|---|
Sma3 | AT5G35530; At2g31610; At3g53870; At5g35530; CHLREDRAFT_134051; F5K20_170; GSVIVT00014707001; GSVIVT00016476001; GSVIVT00032259001; GSVIVT00034104001; LOC_Os03g38000; MICPUCDRAFT_26239; MICPUN_91459; MOK9.14; OSJNBa0008D12.4; OSJNBa0072I06.38; OSJNBb0018L1 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | small ribosomal subunit | GO:0015935 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | cytosolic small ribosomal subunit | GO:0022627 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribosomal protein S3, C-terminal | IPR001351 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | K Homology domain, type 2 | IPR004044 | - | 0.0 | - |
Sma3 | K Homology domain | IPR004087 | - | 0.0 | - |
Sma3 | Ribosomal protein S3, eukaryotic/archaeal | IPR005703 | - | 0.0 | - |
Sma3 | K homology domain-like, alpha/beta | IPR015946 | - | 0.0 | - |
Sma3 | Ribosomal protein S3, conserved site | IPR018280 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G35530.1 | Ribosomal protein S3 family protein chr5:13710355-13712192 REVERSE LENGTH=248 | 7.0e-17 | 79% |
RefSeq | Arabidopsis thaliana | NP_198403.1 | 40S ribosomal protein S3-3 [Arabidopsis thaliana] | 9.0e-17 | 79% |
RefSeq | Populus trichocarpa | XP_002318635.1 | predicted protein [Populus trichocarpa] | 6.0e-17 | 79% |
![]() |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NTN5
Fln msg: Distance to subject end: 176 aas, atg_distance in limit (1-15): atg_distance = 15, W2: There is no M at the beginning, your sequence is shorter than subject: 43 - 233
Fln protein:
G
Protein Length:
44
Fln nts:
T
Fln Alignment:
GFIJCBT03HE8DC___GIFKAELNEFLTRQLAEDGYSGVEIRVTPTRTEIIIMATKTLN
A9NTN5_______________GVFFAELNEVLTRELAEDGYSGVEVRVTPMRTEIIIRATRTQN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain