|
||||||
|
UniGene Name: sp_v3.0_unigene75077
Length: 206 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene75077
C |
|
Ace file of the UniGene sp_v3.0_unigene75077
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pentatricopeptide repeat-containing protein, putative n=1 Tax=Ricinus communis RepID=B9S079_RICCO | - | - | 6.0e-17 | 62% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 73% |
| Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 3.669e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g13410; At2g33760; At2g36730; At3g29230; At3g49170; At3g49710; At4g38010; At5g06540; At5g66520; EMB2261; F13K3.13; F15M7.7; F20D10.130; F2K15.30; GSVIVT00000621001; GSVIVT00001706001; GSVIVT00002423001; GSVIVT00006516001; GSVIVT00006973001; GSVIVT00007 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G36730.1 | Pentatricopeptide repeat (PPR) superfamily protein chr2:15405068-15406573 REVERSE LENGTH=501 | 9.0e-20 | 59% |
| RefSeq | Arabidopsis thaliana | NP_181211.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-19 | 59% |
| RefSeq | Populus trichocarpa | XP_002310520.1 | predicted protein [Populus trichocarpa] | 4.0e-22 | 65% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLJ0
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 88 aas, your sequence is shorter than subject: 65 - 644
Fln protein:
H
Protein Length:
66
Fln nts:
C
Fln Alignment:
GFIJCBT03GVGQT___VTFVAVLCACCHAGLVDEGQRYFDDMTKHYHIAPVMEHYGCIVDLLGRAGCLTEAEDFINQ
B8LLJ0_______________VTFVGVLSACCHAGLVDEGRQYFDIMTRFYHITPAMEHYGCMIDLLGRAGCFDEANDLINK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
