UniGene Name: sp_v3.0_unigene75005
Length: 196 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene75005
G |
Ace file of the UniGene sp_v3.0_unigene75005
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative pre-mRNA-splicing factor ATP-dependent RNA helicase [Arabidopsis thaliana] sp|O22899.1|DHX15_ARATH RecName: Full=Probable pre-mRNA-splicing factor ATP-dependent RNA helicase gb|AAB63825.1| putative pre-mRNA splicing factor RNA helicase [Arabidops | - | - | 1.0e-21 | 91% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
| Sma3 | ATP-dependent RNA helicase, putative | - | - | 1.161e-18 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g16680; ATH1; At1g32490; At2g35340; At2g47250; At3g26560; At3g62310; At5g13010; CHLREDRAFT_127996; F5D14.27; GSVIVT00002999001; GSVIVT00016254001; GSVIVT00028144001; GSVIVT00030750001; GSVIVT00033641001; GSVIVT00035046001; GSVIVT00035061001; LOC_Os03g1 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | adenylate kinase activity | GO:0004017 | Molecular Function | 0.0 | - |
| Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | mRNA processing | GO:0006397 | Biological Process | 0.0 | - |
| Sma3 | RNA splicing | GO:0008380 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | posttranscriptional gene silencing by RNA | GO:0035194 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Adenylate kinase | IPR000850 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | DNA/RNA helicase, ATP-dependent, DEAH-box type, conserved site | IPR002464 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Ribosomal protein S1, RNA-binding domain | IPR003029 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Adenylate kinase, subfamily | IPR006259 | - | 0.0 | - |
| Sma3 | Helicase-associated domain | IPR007502 | - | 0.0 | - |
| Sma3 | Adenylate kinase, active site lid domain | IPR007862 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF1605 | IPR011709 | - | 0.0 | - |
| Sma3 | Nucleic acid-binding, OB-fold | IPR012340 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
| Sma3 | IPR014021 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G62310.1 | RNA helicase family protein chr3:23057516-23060561 REVERSE LENGTH=726 | 2.0e-27 | 91% |
| RefSeq | Arabidopsis thaliana | NP_191790.1 | pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15/PRP43 [Arabidopsis thaliana] | 2.0e-27 | 91% |
| RefSeq | Populus trichocarpa | XP_002301528.1 | predicted protein [Populus trichocarpa] | 6.0e-28 | 92% |
Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5ADJ5
Fln msg: Distance to subject end: 310 aas, your sequence is shorter than subject: 43 - 348
Fln protein:
M
Protein Length:
44
Fln nts:
G
Fln Alignment:
GFIJCBT03GUKX4___PEILRSNLANVVLTLKKLGIDDLVHFDFMDPP
D5ADJ5_______________PEIQRTNLGNVVLLLKSLNIENLLDFDFMDPP

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta