UniGene Name: sp_v3.0_unigene74988
Length: 148 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene74988
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q7Y211.2|PP285_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g57430, chloroplastic; Flags: Precursor gb|AEE79654.1| pentatricopeptide repeat-containing protein [Ara | - | - | 2.0e-12 | 76% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 74% |
Sma3 | Pentatricopeptide repeat protein | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | At1g20230; At1g47580; At2g22070; At3g12770; At3g23330; At3g46790; At3g57430; At4g30700; At4g33170; CRR2; DYW9; F16N3.14; F4I10.100; GSVIVT00005426001; GSVIVT00006467001; GSVIVT00010543001; GSVIVT00011403001; GSVIVT00013497001; GSVIVT00014707001; GSVIVT000 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | thiamine biosynthetic process | GO:0009228 | Biological Process | 0.0 | - |
Sma3 | chloroplast RNA processing | GO:0031425 | Biological Process | 0.0 | - |
Sma3 | polycistronic mRNA processing | GO:0031426 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Ribosomal protein S3, C-terminal | IPR001351 | - | 0.0 | - |
Sma3 | Thiamine biosynthesis protein ThiC | IPR002817 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | K Homology domain, type 2 | IPR004044 | - | 0.0 | - |
Sma3 | K Homology domain | IPR004087 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Methyltransferase type 11 | IPR013216 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G57430.1 | OTP84 Tetratricopeptide repeat (TPR)-like superfamily protein chr3:21255731-21258403 REVERSE LENGTH=890 | 4.0e-17 | 76% |
RefSeq | Arabidopsis thaliana | NP_191302.2 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 5.0e-17 | 76% |
RefSeq | Populus trichocarpa | XP_002299387.1 | predicted protein [Populus trichocarpa] | 2.0e-18 | 79% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0W0
Fln msg: Distance to subject end: 36 aas, your sequence is shorter than subject: 49 - 370
Fln protein:
V
Protein Length:
50
Fln nts:
G
Fln Alignment:
GFIJCBT03HIDFC___VLHDLEEEEKESMLCGHSEKLAIAFGLINTPPGTIIRITKNLR
A9P0W0_______________VLHDVEEEQKEWILGHHSEKLAIAFGIISTPPGTTIRVVKNLR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain