UniGene Name: sp_v3.0_unigene74985
Length: 223 nt
UniGene Fasta |
---|
>sp_v3.0_unigene74985
G |
Ace file of the UniGene sp_v3.0_unigene74985 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Endo-beta-1,4-glucanase n=1 Tax=Pinus radiata RepID=O64401_PINRA | - | - | 5.0e-18 | 60% |
FL-Next | tr=Endo-beta-1,4-glucanase; Pinus radiata (Monterey pine) (Pinus insignis). | - | - | 0.0 | 68% |
Sma3 | Endo-beta-1,4-glucanase | - | - | 8.307e-38 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cellulase. | EC:3.2.1.4 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | 6J23.18; Al-cel1; At1g02800; At1g19940; At1g22880; At1g23210; At1g48930; At1g64390; At1g70710; At1g71380; At1g75680; At2g32990; At2g44540; At2g44550; At2g44560; At2g44570; At4g02290; At4g09740; At4g11050; At4g23560; At4g38990; At4g39000; At4g39010; B1011A |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | NADH dehydrogenase (ubiquinone) activity | GO:0008137 | Molecular Function | 0.0 | - |
Sma3 | cellulase activity | GO:0008810 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | pattern specification process | GO:0007389 | Biological Process | 0.0 | - |
Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
Sma3 | fruit ripening | GO:0009835 | Biological Process | 0.0 | - |
Sma3 | cellulose catabolic process | GO:0030245 | Biological Process | 0.0 | - |
Sma3 | cell wall modification involved in multidimensional cell growth | GO:0042547 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycoside hydrolase, family 9 | IPR001701 | - | 0.0 | - |
Sma3 | Six-hairpin glycosidase | IPR012341 | - | 0.0 | - |
Sma3 | NADH:ubiquinone oxidoreductase, B12 subunit | IPR012576 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 9, active site | IPR018221 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G39010.1 | AtGH9B18, GH9B18 glycosyl hydrolase 9B18 chr4:18176162-18179102 REVERSE LENGTH=497 | 2.0e-21 | 63% |
RefSeq | Arabidopsis thaliana | NP_568050.1 | endoglucanase 24 [Arabidopsis thaliana] | 2.0e-21 | 63% |
RefSeq | Populus trichocarpa | XP_002305460.1 | predicted protein [Populus trichocarpa] | 4.0e-22 | 64% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: O64401
Fln msg: Distance to subject end: 268 aas, your sequence is shorter than subject: 74 - 510
Fln protein:
E
Protein Length:
75
Fln nts:
G
Fln Alignment:
GFIJCBT03G9U1W___ERPEDMDTSRTVYSIDAENPGSDVAGETXXXXXXXSIVFQSSDFDYSQRLLETATQLFEFADTYRGAYSDTQR
O64401_______________ERPEDMDTARTVYKIDSQHPGSDVAAETAAALAAASLVFRKSDPQYSKRLIHTAMRVFDFADKHRGAYSDSLR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain