UniGene Name: sp_v3.0_unigene74942
Length: 233 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene74942
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pectinesterase n=1 Tax=Picea sitchensis RepID=C0PT44_PICSI | - | - | 5.0e-21 | 70% |
FL-Next | sp=Pectinesterase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
Sma3 | Pectinesterase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pectinesterase. | EC:3.1.1.11 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pentose and glucuronate interconversions | 00040 | 0.0 | % | |
Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | ARATH32; ARATH39; ARATH4; ARATH40; ARATH61; ARATH8; At1g11580; At1g53830; At3g43270; At4g02300; At4g02320; At5g53370; B1011A07.22; F7K15.120; GSVIVT00006908001; GSVIVT00012763001; GSVIVT00017261001; GSVIVT00017264001; GSVIVT00017266001; GSVIVT00017269001; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | enzyme inhibitor activity | GO:0004857 | Molecular Function | 0.0 | - |
Sma3 | translation release factor activity, codon specific | GO:0016149 | Molecular Function | 0.0 | - |
Sma3 | pectinesterase activity | GO:0030599 | Molecular Function | 0.0 | - |
Sma3 | aspartyl esterase activity | GO:0045330 | Molecular Function | 0.0 | - |
Sma3 | translational termination | GO:0006415 | Biological Process | 0.0 | - |
Sma3 | fruit ripening | GO:0009835 | Biological Process | 0.0 | - |
Sma3 | cell wall modification | GO:0042545 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pectinesterase, catalytic | IPR000070 | - | 0.0 | - |
Sma3 | Peptide chain release factor class I/class II | IPR000352 | - | 0.0 | - |
Sma3 | Peptide chain release factor 1 | IPR004373 | - | 0.0 | - |
Sma3 | Peptide chain release factor | IPR005139 | - | 0.0 | - |
Sma3 | Pectinesterase inhibitor | IPR006501 | - | 0.0 | - |
Sma3 | Pectin lyase fold | IPR012334 | - | 0.0 | - |
Sma3 | Pectinesterase, active site | IPR018040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G02320.1 | Plant invertase/pectin methylesterase inhibitor superfamily chr4:1022725-1026118 REVERSE LENGTH=518 | 8.0e-22 | 61% |
RefSeq | Arabidopsis thaliana | NP_192141.1 | pectinesterase 40 [Arabidopsis thaliana] | 1.0e-21 | 61% |
RefSeq | Populus trichocarpa | XP_002322399.1 | predicted protein [Populus trichocarpa] | 1.0e-23 | 68% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: C0PT44
Fln msg: STOP codon was not found. Distance to subject end: 14 aas, your sequence is shorter than subject: 77 - 601
Fln protein:
N
Protein Length:
78
Fln nts:
A
Fln Alignment:
GFIJCBT03GCRQI___GGLNQVAGWIEWNGPFALNTLYYGEYMNRGPGADTTNRVKWAGYRRISSSREASQFTVSKFMEGN
C0PT44_______________GDLIQPAGWLEWNGNFALNTLYYGEFMNRGPGAGVANRVRWPGYRAIRSSNEAKQFTVSQFIKGD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain