UniGene Name: sp_v3.0_unigene74935
Length: 245 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene74935
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Citrate synthase n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0DAI7_LACBS | - | - | 5.0e-33 | 88% |
FL-Next | sp=Citrate synthase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
Sma3 | Citrate synthase | - | - | 2.744e-33 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Citrate (Si)-synthase. | EC:2.3.3.1 | - | 3.057e-07 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Citrate cycle (TCA cycle) | 00020 | 3.057e-07 | % | |
Sma3 | Glyoxylate and dicarboxylate metabolism | 00630 | 3.057e-07 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 3.057e-07 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 3.057e-07 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 3.057e-07 | % | |
Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 3.057e-07 | % | |
Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 3.057e-07 | % | |
Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 3.057e-07 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 3.057e-07 | % | |
Sma3 | Metabolic pathways | 01100 | 3.057e-07 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.057e-07 | % |
Source | Gene names |
---|---|
Sma3 | At2g44350; CIS2; CS; CSN1; CSY4; F4I1.16; LOC_Os11g33240; MCSI; MICPUCDRAFT_43905; MICPUN_77978; Os02g0194100; Os11g0538900; OsI_06215; OsI_36380; OsJ_05734; OsJ_34145; Ot05g01770; P0437H03.132; PHYPADRAFT_140151; PHYPADRAFT_179651; POPTRDRAFT_837325; THA |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial matrix | GO:0005759 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | citrate (Si)-synthase activity | GO:0004108 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | lyase activity | GO:0016829 | Molecular Function | 0.0 | - |
Sma3 | transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer | GO:0046912 | Molecular Function | 0.0 | - |
Sma3 | tricarboxylic acid cycle | GO:0006099 | Biological Process | 0.0 | - |
Sma3 | cellular carbohydrate metabolic process | GO:0044262 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Citrate synthase-like | IPR002020 | - | 0.0 | - |
Sma3 | Citrate synthase, eukaryotic | IPR010109 | - | 0.0 | - |
Sma3 | Citrate synthase-like, large alpha subdomain | IPR016142 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G44350.2 | ATCS, CSY4 Citrate synthase family protein chr2:18316673-18320524 FORWARD LENGTH=474 | 6.0e-19 | 57% |
RefSeq | Arabidopsis thaliana | NP_566016.1 | citrate synthase 4 [Arabidopsis thaliana] | 8.0e-19 | 57% |
RefSeq | Populus trichocarpa | XP_002330895.1 | predicted protein [Populus trichocarpa] | 2.0e-18 | 54% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLL1
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 190 aas, your sequence is shorter than subject: 81 - 477
Fln protein:
R
Protein Length:
82
Fln nts:
G
Fln Alignment:
GFIJCBT03F00PN___PNIAGRIYRNVFGQGKLPSIDPTKDYSHNLATLLGFGNDEAFVELMRLYITIHSDHEGGNVSAHTGKLVGS
B8LLL1_______________PIIASYIYRRIYKGGKIIPSSDSLDYAANFASMLGF-NDPKMHELMRLYVTIHSDHEGGNVSAHTVRLVGS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain