UniGene Name: sp_v3.0_unigene74918
Length: 204 nt
UniGene Fasta |
---|
>sp_v3.0_unigene74918
G |
Ace file of the UniGene sp_v3.0_unigene74918 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | U-box domain containing protein | - | - | 9.0e-11 | 50% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 71% |
Sma3 | Putative immediate-early fungal elicitor protein | - | - | 3.64e-08 | - |
Source | Gene names |
---|---|
Sma3 | At3g52450; CMPG1; F22O6_170; GSVIVT00016120001; GSVIVT00017530001; GSVIVT00030628001; GSVIVT00036615001; GSVIVT00038904001; GSVIVT00038906001; GSVIVT00038907001; H0723C07.7; MtrDRAFT_AC148290g16v2; OJ1743_B12.39; OSIGBa0092M08.11; OSJNBa0014M17.24; OSJNBa |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ubiquitin ligase complex | GO:0000151 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | proton-transporting two-sector ATPase complex, catalytic domain | GO:0033178 | Cellular Component | 0.0 | - |
Sma3 | ubiquitin-protein ligase activity | GO:0004842 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances | GO:0016820 | Molecular Function | 0.0 | - |
Sma3 | respiratory burst involved in defense response | GO:0002679 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
Sma3 | ATP synthesis coupled proton transport | GO:0015986 | Biological Process | 0.0 | - |
Sma3 | protein ubiquitination | GO:0016567 | Biological Process | 0.0 | - |
Sma3 | modification-dependent protein catabolic process | GO:0019941 | Biological Process | 0.0 | - |
Sma3 | protein autoubiquitination | GO:0051865 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
Sma3 | U box domain | IPR003613 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G52450.1 | PUB22 plant U-box 22 chr3:19440943-19442250 REVERSE LENGTH=435 | 7.0e-14 | 70% |
RefSeq | Arabidopsis thaliana | NP_190813.1 | E3 ubiquitin-protein ligase PUB22 [Arabidopsis thaliana] | 9.0e-14 | 70% |
RefSeq | Populus trichocarpa | XP_002314259.1 | predicted protein [Populus trichocarpa] | 1.0e-13 | 64% |
Full-Lengther Next Prediction |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NXN2
Fln msg: Distance to subject end: 372 aas, your sequence is shorter than subject: 49 - 417
Fln protein:
M
Protein Length:
50
Fln nts:
G
Fln Alignment:
GFIJCBT03F4QTF___EVPSYFRCPISMELMRDPVTVSTGMTYDRESIEHW
A9NXN2_______________EIPSYFICPISMQIMRDPITVCTSITYDRESMEKW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain