UniGene Name: sp_v3.0_unigene74752
Length: 176 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene74752
G |
Ace file of the UniGene sp_v3.0_unigene74752
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Anthocyanidin reductase n=4 Tax=Pyreae RepID=A0EM49_PYRCO | - | - | 2.0e-15 | 71% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
| Sma3 | Dihydroflavonol 4-reductase | - | - | 1.9422e-42 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Dihydrokaempferol 4-reductase. | EC:1.1.1.219 | - | 1.036e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid biosynthesis | 00941 | 1.036e-07 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.036e-07 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.036e-07 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.036e-07 | % | |
| Sma3 | Anthocyanidin reductase. | EC:1.3.1.77 | - | 2.516e-08 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid biosynthesis | 00941 | 2.516e-08 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 2.516e-08 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.516e-08 | % |
| Source | Gene names |
|---|---|
| Sma3 | ANR; ANR/BAN1; ANR/BAN2; At1g61720; BAN; DFR; DFR-B; DFR-FL1; DFR-FL2; DFR1; DFR3; DFR4; DFR5; F4N21_7; GSVIVT00005344001; LAR; LCR; POPTRDRAFT_831060; POPTRDRAFT_834000; RCOM_0906590; RCOM_0964770; T13M11.8; VITISV_013443; VvANR; ban; dfr; dfr1-1; dfr2-1 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | anthocyanidin reductase activity | GO:0033729 | Molecular Function | 0.0 | - |
| Sma3 | dihydrokaempferol 4-reductase activity | GO:0045552 | Molecular Function | 0.0 | - |
| Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
| Sma3 | negative regulation of flavonoid biosynthetic process | GO:0009964 | Biological Process | 0.0 | - |
| Sma3 | cellular metabolic process | GO:0044237 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | NAD-dependent epimerase/dehydratase | IPR001509 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G61720.1 | BAN NAD(P)-binding Rossmann-fold superfamily protein chr1:22791326-22792757 REVERSE LENGTH=340 | 4.0e-19 | 59% |
| RefSeq | Arabidopsis thaliana | NP_176365.1 | anthocyanidin reductase [Arabidopsis thaliana] | 6.0e-19 | 59% |
| RefSeq | Populus trichocarpa | XP_002305639.1 | anthocyanidin reductase [Populus trichocarpa] | 4.0e-20 | 68% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRT5
Fln msg: Distance to subject end: 196 aas, your sequence is shorter than subject: 58 - 342
Fln protein:
G
Protein Length:
59
Fln nts:
G
Fln Alignment:
GFIJCBT03GLI3D___GVFHVASPVNFNPNDPERDVMKPAINGTLNVLRACSKAKTVKRVVVTSSACTASIN
B8LRT5_______________GVFHVATPIDFEPKDPENDVIKPAINGTLNVLKSCTKSKTVKRVVVTSSAATVSIN

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta