UniGene Name: sp_v3.0_unigene74711
Length: 228 nt
![]() |
---|
>sp_v3.0_unigene74711
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cinnamyl-alcohol dehydrogenase family n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KJR0_ARALL | - | - | 6.0e-17 | 67% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 64% |
Sma3 | Cinnamoyl-CoA reductase, putative | - | - | 7.129e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Dihydrokaempferol 4-reductase. | EC:1.1.1.219 | - | 1.381e-10 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Flavonoid biosynthesis | 00941 | 1.381e-10 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.381e-10 | % | |
Sma3 | Metabolic pathways | 01100 | 1.381e-10 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.381e-10 | % | |
Sma3 | Cinnamoyl-CoA reductase. | EC:1.2.1.44 | - | 8.816e-06 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phenylpropanoid biosynthesis | 00940 | 8.816e-06 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 8.816e-06 | % | |
Sma3 | Metabolic pathways | 01100 | 8.816e-06 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 8.816e-06 | % |
Source | Gene names |
---|---|
Sma3 | ADH; At1g09490; CAD; CAD1; CAD1-1; CAD1-7; CCR; CCRL1; CCRL3; CCRL4; CHLREDRAFT_194674; F14J9.15; GSVIVT00000921001; GSVIVT00008929001; GSVIVT00008931001; GSVIVT00024587001; GSVIVT00024588001; GSVIVT00028731001; GSVIVT00033897001; H0105C05.2; H0323C08.18; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | cinnamoyl-CoA reductase activity | GO:0016621 | Molecular Function | 0.0 | - |
Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | cellular metabolic process | GO:0044237 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | NAD-dependent epimerase/dehydratase | IPR001509 | - | 0.0 | - |
Sma3 | Male sterility, NAD-binding | IPR013120 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G09490.1 | NAD(P)-binding Rossmann-fold superfamily protein chr1:3064172-3065815 FORWARD LENGTH=322 | 4.0e-19 | 70% |
RefSeq | Arabidopsis thaliana | NP_172420.1 | Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis thaliana] | 5.0e-19 | 70% |
RefSeq | Populus trichocarpa | XP_002314050.1 | cinnamoyl CoA reductase-like protein [Populus trichocarpa] | 2.0e-17 | 67% |
![]() |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NVF9
Fln msg: Overlapping hits, possible frame ERROR between 122 and 112, Distance to subject end: 255 aas, atg_distance in limit (1-15): atg_distance = 15, your sequence is shorter than subject: 75 - 344
Fln protein:
M
Protein Length:
76
Fln nts:
A
Fln Alignment:
GFIJCBT03FU420___VCVTGAGGYIASCLIKNLLQRGYTVNATLRNPNxxxxTGPLLSLPGAAERLKLFQADLSEEGAFDSAVEGC
A9NVF9_______________VCVTGAAGFMASWLVKRLLDKGYTVHATVRDPDxxxxVHHLLDIPGAAERLKLFRAELSEDGSFDAAVAGC
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain