|
||||||
|
UniGene Name: sp_v3.0_unigene74623
Length: 135 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene74623
A |
|
Ace file of the UniGene sp_v3.0_unigene74623 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cellulose synthase-like D5, glycosyltransferase family 2 n=2 Tax=Physcomitrella patens RepID=E1C9R0_PHYPA | - | - | 2.0e-10 | 75% |
| FL-Next | sp=Cellulose synthase-like protein D4; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 70% |
| Sma3 | Cellulose synthase-like protein D4 | - | - | 3.052e-11 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 3.364e-20 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Starch and sucrose metabolism | 00500 | 5.059e-10 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g02730; At2g33100; At3g03050; At4g38190; At5g16910; CSLD1; CSLD2; CSLD3; CSLD4; CSLD5; CslD1; F20D10.310; F22D16.26; F25I18.16; F2K13.60; GSVIVT00015671001; KJK; LOC_Os12g36890; Os12g0555600; OsI_022026; OsI_027835; OsI_34786; OsI_38690; OsJ_035046; PH |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | integral to Golgi membrane | GO:0030173 | Cellular Component | 0.0 | - |
| Sma3 | cellulose synthase (UDP-forming) activity | GO:0016760 | Molecular Function | 0.0 | - |
| Sma3 | 1,4-beta-D-xylan synthase activity | GO:0047517 | Molecular Function | 0.0 | - |
| Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | pollen germination | GO:0009846 | Biological Process | 0.0 | - |
| Sma3 | cellulose biosynthetic process | GO:0030244 | Biological Process | 0.0 | - |
| Sma3 | cell wall biogenesis | GO:0042546 | Biological Process | 0.0 | - |
| Sma3 | shoot development | GO:0048367 | Biological Process | 0.0 | - |
| Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cellulose synthase | IPR005150 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G38190.1 | ATCSLD4, CSLD4 cellulose synthase like D4 chr4:17910096-17913641 REVERSE LENGTH=1111 | 2.0e-14 | 70% |
| RefSeq | Arabidopsis thaliana | NP_195532.1 | cellulose synthase-like protein D4 [Arabidopsis thaliana] | 2.0e-14 | 70% |
| RefSeq | Populus trichocarpa | XP_002313568.1 | predicted protein [Populus trichocarpa] | 9.0e-15 | 72% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SZL9
Fln msg: Distance to subject end: 334 aas, your sequence is shorter than subject: 44 - 1111
Fln protein:
S
Protein Length:
45
Fln nts:
A
Fln Alignment:
GFIJCBT03GEUXE___SVTLSASIPIAEYQGRPLADQQGVKNGRPPGALAIPREPLDAAT
Q9SZL9_______________STLLAESIPIAEFQGRPLADHPAVKYGRPPGALRVPRDPLDATT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
