UniGene Name: sp_v3.0_unigene74451
Length: 210 nt
![]() |
---|
>sp_v3.0_unigene74451
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ubiquitin carboxyl-terminal hydrolase 12 [Arabidopsis thaliana] gb|AAK25908.1|AF360198_1 putative ubiquitin-specific protease UBP12 [Arabidopsis thaliana] gb|AAN13185.1| putative ubiquitin-specific protease UBP12 [Arabidopsis thaliana] gb|AED91040.1| ubiq | - | - | 6.0e-17 | 58% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
Source | Gene names |
---|---|
Sma3 | At5g06600; CM0545.290.nc; F15M7.13; GSVIVT00002647001; GSVIVT00017456001; GSVIVT00027113001; LOC_Os11g36470; OsI_36553; OsJ_34325; PHYPADRAFT_180457; PHYPADRAFT_216093; POPTRDRAFT_256091; POPTRDRAFT_561195; RCOM_0737410; RCOM_0941540; UBP12; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Zinc finger, GATA-type | IPR000679 | - | 0.0 | - |
Sma3 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 | IPR001394 | - | 0.0 | - |
Sma3 | MATH | IPR002083 | - | 0.0 | - |
Sma3 | Tify | IPR010399 | - | 0.0 | - |
Sma3 | CCT domain | IPR010402 | - | 0.0 | - |
Sma3 | TRAF-type | IPR013322 | - | 0.0 | - |
Sma3 | Small acid-soluble spore protein, alpha/beta-type, conserved site | IPR018126 | - | 0.0 | - |
Sma3 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2, conserved site | IPR018200 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G06600.1 | UBP12 ubiquitin-specific protease 12 chr5:2019545-2027834 REVERSE LENGTH=1116 | 8.0e-22 | 58% |
RefSeq | Arabidopsis thaliana | NP_001119179.1 | ubiquitin carboxyl-terminal hydrolase 12 [Arabidopsis thaliana] | 1.0e-21 | 58% |
RefSeq | Populus trichocarpa | XP_002322753.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-21 | 55% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NSM8
Fln msg: STOP codon was not found. Distance to subject end: 17 aas, your sequence is shorter than subject: 69 - 123
Fln protein:
Y
Protein Length:
70
Fln nts:
G
Fln Alignment:
GFIJCBT03HD3NA___NVDCLSIYLEVADSAKLPHDWSKYADFSLAIVNQIDHQLTVKR
A9NSM8_______________NVDYLSIYLDVPDSATLPHGCSKYAEFSLAVVNLTDPQLTIRK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain