UniGene Name: sp_v3.0_unigene74430
Length: 213 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene74430
T |
Ace file of the UniGene sp_v3.0_unigene74430 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cytochrome P450 enzyme [Pisum sativum] | - | - | 1.0e-16 | 60% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 30% |
| Sma3 | Cytochrome P450 probable 6-deoxoteasterone to 3-dehydro 6-deoxoteasterone or teasterone to 3-dehydro teasterone | - | - | 4.425e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ent-kaurenoic acid oxidase. | EC:1.14.13.79 | - | 6.014e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Diterpenoid biosynthesis | 00904 | 6.014e-07 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 6.014e-07 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 6.014e-07 | % | |
| Sma3 | Metabolic pathways | 01100 | 6.014e-07 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 6.014e-07 | % |
| Source | Gene names |
|---|---|
| Sma3 | At3g13730; CYP90D; CYP90D5; CYP90D6; GSVIVT00034159001; GSVIVT00036865001; POPTRDRAFT_678468; POPTRDRAFT_703918; POPTRDRAFT_802964; RCOM_0312700; RCOM_0533200; VITISV_007910; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NADH or NADPH as one donor, and incorporation of one atom of oxygen | GO:0016709 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | brassinosteroid biosynthetic process | GO:0016132 | Biological Process | 0.0 | - |
| Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
| Sma3 | petal development | GO:0048441 | Biological Process | 0.0 | - |
| Sma3 | stamen development | GO:0048443 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G36380.1 | ROT3 Cytochrome P450 superfamily protein chr4:17187973-17192202 REVERSE LENGTH=524 | 2.0e-21 | 55% |
| RefSeq | Arabidopsis thaliana | NP_568002.1 | 3-epi-6-deoxocathasterone 23-monooxygenase [Arabidopsis thaliana] | 2.0e-21 | 55% |
| RefSeq | Populus trichocarpa | XP_002329023.1 | cytochrome P450 probable 6-deoxoteasterone to 3-dehydro 6-deoxoteasterone or teasterone to 3-dehydro teasterone [Populus trichocarpa] | 8.0e-22 | 59% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P221
Fln msg: Distance to subject end: 228 aas, your sequence is shorter than subject: 70 - 432
Fln protein:
I
Protein Length:
71
Fln nts:
T
Fln Alignment:
GFIJCBT03FYOUX___IAFHVLLKALMSLTPGDDMECLKQEFRKFISGLVSLPVKLPGTRLYNSLKAKARMVKMVHRIIEEKRSN
A9P221_______________MALLLSLKQVMSMNSGPKAEAFMLEFYKLVEGTISMPINLPGTSYRRGFQARENVLRMLREVLRERRAS

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)