SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene74423

Length: 143 nt

UniGene Fasta

>sp_v3.0_unigene74423
TCCTCCTGTGGACATTATTATCACTACAGCAGATCCTTTCAAAGAGCCTGCTATAATCACTGCTAACACAGTTCTTTCGGTACTTGCAATTGATTATCCAATCGAAAAATTCTCATGCTATGTCTCAGACGACGCTGCTTCTC

Ace file of the UniGene sp_v3.0_unigene74423

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	cellulose synthase [Populus tremula x Populus tremuloides]	-	-	5.0e-13	69%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	89%
Sma3	Cellulose synthase	-	-	2.74654e-43	-

Source	ECs	Term	Type	e value	Identity
Sma3	Cellulose synthase (UDP-forming).	EC:2.4.1.12	-	0.0	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Starch and sucrose metabolism	00500		0.0	%

Source	Gene names
Sma3	ATHA; ATHB; At2g21770; At4g18780; At4g39350; At5g05170; At5g17420; At5g44030; At5g64740; CESA09; CESA2; CESA3; CESA4; CESA5; CESA6; CESA7; CESA8; CESA9; CEV1; CSLD2; CesA; CesA-4; CesA-5; CesA-9; CesA1; CesA10; CesA11; CesA12; CesA2; CesA3; CesA3-1; CesA4

Source	GOs	Term	Type	Identity
Sma3	Golgi membrane	GO:0000139	Cellular Component	-
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	Golgi apparatus	GO:0005794	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	cellulose synthase complex	GO:0010330	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	cellulose synthase (UDP-forming) activity	GO:0016760	Molecular Function	-
Sma3	defense response	GO:0006952	Biological Process	-
Sma3	response to osmotic stress	GO:0006970	Biological Process	-
Sma3	cellular cell wall organization	GO:0007047	Biological Process	-
Sma3	response to water deprivation	GO:0009414	Biological Process	-
Sma3	primary cell wall biogenesis	GO:0009833	Biological Process	-
Sma3	secondary cell wall biogenesis	GO:0009834	Biological Process	-
Sma3	positive regulation of abscisic acid biosynthetic process	GO:0010116	Biological Process	-
Sma3	rhamnogalacturonan I side chain metabolic process	GO:0010400	Biological Process	-
Sma3	cell growth	GO:0016049	Biological Process	-
Sma3	cellulose biosynthetic process	GO:0030244	Biological Process	-
Sma3	defense response to bacterium	GO:0042742	Biological Process	-
Sma3	cortical microtubule organization	GO:0043622	Biological Process	-
Sma3	defense response to fungus	GO:0050832	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Pyridine nucleotide-disulphide oxidoreductase, class-II	IPR000103	-	-
Sma3	WD40 repeat	IPR001680	-	-
Sma3	Zinc finger, RING-type	IPR001841	-	-
Sma3	Lipocalin	IPR002345	-	-
Sma3	Cellulose synthase	IPR005150	-	-
Sma3	WD40/YVTN repeat-like-containing domain	IPR015943	-	-
Sma3	Zinc finger, RING-type, conserved site	IPR017907	-	-
Sma3	WD40-repeat-containing domain	IPR017986	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-
Sma3		IPR019782	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G44030.1	CESA4, IRX5, NWS2 cellulose synthase A4 chr5:17714713-17719564 FORWARD LENGTH=1049	1.0e-17	69%
RefSeq	Arabidopsis thaliana	NP_199216.2	cellulose synthase A catalytic subunit 4 [UDP-forming] [Arabidopsis thaliana]	2.0e-17	69%
RefSeq	Populus trichocarpa	XP_002301856.1	cellulose synthase [Populus trichocarpa]	1.0e-17	69%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LP88

Fln msg: Distance to subject end: 627 aas, your sequence is shorter than subject: 47 - 785

Fln protein: PPVDIIITTADPFKEPAIITANTVLSVLAIDYPIEKFSCYVSDDAAS

Protein Length: 48

Fln nts: TCCTCCTGTGGACATTATTATCACTACAGCAGATCCTTTCAAAGAGCCTGCTATAATCACTGCTAACACAGTTCTTTCGGTACTTGCAATTGATTATCCAATCGAAAAATTCTCATGCTATGTCTCAGACGACGCTGCTTCTC

Fln Alignment:

GFIJCBT03FU48Y___PPVDIIITTADPFKEPAIITANTVLSVLAIDYPIEKFSCYVSDDAAS
B8LP88_______________PPVDIIITTADPFKEPAIITANTVLSVLAIDYPVQKFACYISDDGAS

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain