UniGene Name: sp_v3.0_unigene74423
Length: 143 nt
![]() |
---|
>sp_v3.0_unigene74423
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | cellulose synthase [Populus tremula x Populus tremuloides] | - | - | 5.0e-13 | 69% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 89% |
Sma3 | Cellulose synthase | - | - | 2.74654e-43 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cellulose synthase (UDP-forming). | EC:2.4.1.12 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | ATHA; ATHB; At2g21770; At4g18780; At4g39350; At5g05170; At5g17420; At5g44030; At5g64740; CESA09; CESA2; CESA3; CESA4; CESA5; CESA6; CESA7; CESA8; CESA9; CEV1; CSLD2; CesA; CesA-4; CesA-5; CesA-9; CesA1; CesA10; CesA11; CesA12; CesA2; CesA3; CesA3-1; CesA4 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | cellulose synthase complex | GO:0010330 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | cellulose synthase (UDP-forming) activity | GO:0016760 | Molecular Function | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | response to osmotic stress | GO:0006970 | Biological Process | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | primary cell wall biogenesis | GO:0009833 | Biological Process | 0.0 | - |
Sma3 | secondary cell wall biogenesis | GO:0009834 | Biological Process | 0.0 | - |
Sma3 | positive regulation of abscisic acid biosynthetic process | GO:0010116 | Biological Process | 0.0 | - |
Sma3 | rhamnogalacturonan I side chain metabolic process | GO:0010400 | Biological Process | 0.0 | - |
Sma3 | cell growth | GO:0016049 | Biological Process | 0.0 | - |
Sma3 | cellulose biosynthetic process | GO:0030244 | Biological Process | 0.0 | - |
Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
Sma3 | cortical microtubule organization | GO:0043622 | Biological Process | 0.0 | - |
Sma3 | defense response to fungus | GO:0050832 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class-II | IPR000103 | - | 0.0 | - |
Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
Sma3 | Cellulose synthase | IPR005150 | - | 0.0 | - |
Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type, conserved site | IPR017907 | - | 0.0 | - |
Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Sma3 | IPR019782 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G44030.1 | CESA4, IRX5, NWS2 cellulose synthase A4 chr5:17714713-17719564 FORWARD LENGTH=1049 | 1.0e-17 | 69% |
RefSeq | Arabidopsis thaliana | NP_199216.2 | cellulose synthase A catalytic subunit 4 [UDP-forming] [Arabidopsis thaliana] | 2.0e-17 | 69% |
RefSeq | Populus trichocarpa | XP_002301856.1 | cellulose synthase [Populus trichocarpa] | 1.0e-17 | 69% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LP88
Fln msg: Distance to subject end: 627 aas, your sequence is shorter than subject: 47 - 785
Fln protein:
P
Protein Length:
48
Fln nts:
T
Fln Alignment:
GFIJCBT03FU48Y___PPVDIIITTADPFKEPAIITANTVLSVLAIDYPIEKFSCYVSDDAAS
B8LP88_______________PPVDIIITTADPFKEPAIITANTVLSVLAIDYPVQKFACYISDDGAS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain