UniGene Name: sp_v3.0_unigene74400
Length: 235 nt
UniGene Fasta |
---|
>sp_v3.0_unigene74400
T |
Ace file of the UniGene sp_v3.0_unigene74400 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Kinase, putative n=1 Tax=Ricinus communis RepID=B9S3F4_RICCO | - | - | 4.0e-21 | 64% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
Sma3 | Lectin-like receptor kinase 7 | - | - | 6.47e-18 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 5.613e-07 | - |
Sma3 | Cyclin-dependent kinase. | EC:2.7.11.22 | - | 5.794e-09 | - |
Source | Gene names |
---|---|
Sma3 | AT4g02410; AT4g02420; AT4g04960; At1g15530; At2g37710; At3g45330; At3g45410; At3g45420; At3g45440; At3g53810; At3g59700; At4g02410; At4g02420; At4g04960; At5g59260; At5g60320; AthlecRK3; B1008E06.18; F18N11.170; F18N11.180; F18N11.90; F24G16.10; F5K20_110 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | transmembrane receptor protein serine/threonine kinase activity | GO:0004675 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | IPR001899 | - | 0.0 | - | |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Ribosomal protein L10, eubacterial, conserved site | IPR002363 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
Sma3 | IPR015706 | - | 0.0 | - | |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G02410.1 | Concanavalin A-like lectin protein kinase family protein chr4:1060086-1062110 REVERSE LENGTH=674 | 7.0e-25 | 56% |
RefSeq | Arabidopsis thaliana | NP_567233.1 | concanavalin A-like lectin kinase-like protein [Arabidopsis thaliana] | 9.0e-25 | 56% |
RefSeq | Populus trichocarpa | XP_002314156.1 | predicted protein [Populus trichocarpa] | 1.0e-25 | 60% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLJ6
Fln msg: Distance to subject end: 266 aas, your sequence is shorter than subject: 77 - 704
Fln protein:
G
Protein Length:
78
Fln nts:
T
Fln Alignment:
GFIJCBT03FU0YE___GKVYKGVLPSSGDEVAVKSLMKEFTEGMKGFVAEISTMGRTQHRNLVPLRGWCRIRKQLFIVYDYMPNGSLDRLIFG
B8LLJ6_______________GKVYKGVLPSSGQEVAVKCITKEFTEGMKGFVAEISSMGRLQHRNLVQLRGWCRRHMQLFIVYDYMPNGSLDKLIFG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain