UniGene Name: sp_v3.0_unigene74309
Length: 229 nt
UniGene Fasta |
---|
>sp_v3.0_unigene74309
G |
Ace file of the UniGene sp_v3.0_unigene74309 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | unconventional myosin [Helianthus annuus] | - | - | 1.0e-29 | 78% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 100% |
Sma3 | Myosin XI, putative | - | - | 1.097e-12 | - |
Source | Gene names |
---|---|
Sma3 | AT4g28710; At1g17580; At2g20290; At2g31900; At2g33240; At3g58160; At5g20490; At5g43900; CHLREDRAFT_185104; F16A16.180; F20D22.7; F9D24.70; GSVIVT00003703001; GSVIVT00011761001; GSVIVT00016505001; GSVIVT00020400001; GSVIVT00028463001; GSVIVT00034148001; LO |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | myosin complex | GO:0016459 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | motor activity | GO:0003774 | Molecular Function | 0.0 | - |
Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | actin filament-based movement | GO:0030048 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G04160.1 | XIB, ATXIB, XI-8, XI-B myosin XI B chr1:1086495-1096146 FORWARD LENGTH=1500 | 8.0e-32 | 84% |
RefSeq | Arabidopsis thaliana | NP_171912.2 | myosin XI B [Arabidopsis thaliana] | 1.0e-31 | 84% |
RefSeq | Populus trichocarpa | XP_002303100.1 | predicted protein [Populus trichocarpa] | 1.0e-31 | 78% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: F6HZT6
Fln msg: Overlapping hits, possible frame ERROR between 97 and 96, Distance to subject end: 929 aas, your sequence is shorter than subject: 76 - 1518
Fln protein:
D
Protein Length:
77
Fln nts:
G
Fln Alignment:
GFIJCBT03FOGBJ___DEACMFPRSTHETFSQKLYQTFKNHKRFSKPxLSRTDFTIGHYAGDVTYQTDLFIDKNKDYVVAEHQALLNASNC
F6HZT6_______________DEACMFPRSTHETFSQKLYQTFKNHKRFSKPxLSRTDFTICHYAGDVTYQTDLFLDKNKDYVVAEHQALLSASNC
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain