UniGene Name: sp_v3.0_unigene74308
Length: 248 nt
![]() |
---|
>sp_v3.0_unigene74308
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | rve domain containing protein | - | - | 1.0e-12 | 27% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 55% |
Sma3 | Gag-Pol polyprotein | - | - | 6.235e-07 | - |
Source | Gene names |
---|---|
Sma3 | AT4g10460; At2g17490; F11I4_21; F7L13.40; LOC_Os03g64080; OSJNBa0096I06.16; SDM1_46t00012; T15M6.14; T16L24.270; T18I24.5; T20K12.230; T28P6.8; VITISV_000081; VITISV_001281; VITISV_001383; VITISV_001479; VITISV_001707; VITISV_003097; VITISV_006839; VITISV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | phosphopyruvate hydratase complex | GO:0000015 | Cellular Component | 0.0 | - |
Sma3 | nuclear pore | GO:0005643 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | dihydrofolate reductase activity | GO:0004146 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | phosphopyruvate hydratase activity | GO:0004634 | Molecular Function | 0.0 | - |
Sma3 | ionotropic glutamate receptor activity | GO:0004970 | Molecular Function | 0.0 | - |
Sma3 | extracellular-glutamate-gated ion channel activity | GO:0005234 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | O-methyltransferase activity | GO:0008171 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | protein transporter activity | GO:0008565 | Molecular Function | 0.0 | - |
Sma3 | NADP binding | GO:0050661 | Molecular Function | 0.0 | - |
Sma3 | protein import into nucleus, docking | GO:0000059 | Biological Process | 0.0 | - |
Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
Sma3 | glycine biosynthetic process | GO:0006545 | Biological Process | 0.0 | - |
Sma3 | nucleotide biosynthetic process | GO:0009165 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | transposition | GO:0032196 | Biological Process | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKX7
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 194 aas, your sequence is shorter than subject: 79 - 407
Fln protein:
E
Protein Length:
80
Fln nts:
A
Fln Alignment:
GFIJCBT03GXHDY___LDLIHSEVFGPMFPKSLGGHLYYVTFIDDHSRKTWVYLMKSXXXXXXXXXXXXXXXXNLIERRIKILRFDNGGEYT*KE
B8LKX7_______________LHLVHSDLMGPLEHPSISGSRYVLTFIDDYSRRIWVYFLKNKDEVFEKFKEFKAFVEKQSGKSIKILRTDNGKEYVNKE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain