SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene74308

Length: 248 nt

UniGene Fasta

>sp_v3.0_unigene74308
AAGAAATTTTGGACCTCATTCATTCCGAAGTTTTTGGTCCTATGTTTCCAAAGTCTCTTGGTGGTCATCTCTACTATGTAACATTCATTGATGACCATTCAAGGAAAACTTGGGTTTACTTGATGAAATCCAAGGATGAAGTATTCGTTAAATTTCAAGAATTCAAAGTTGAAGTGGAGAACCTTATAGAAAGGAGAATAAAGATATTGAGGTTTGATAATGGAGGTGAATATACTTAAAAGGAAATT

Ace file of the UniGene sp_v3.0_unigene74308

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	rve domain containing protein	-	-	1.0e-12	27%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	55%
Sma3	Gag-Pol polyprotein	-	-	6.235e-07	-

Source	Gene names
Sma3	AT4g10460; At2g17490; F11I4_21; F7L13.40; LOC_Os03g64080; OSJNBa0096I06.16; SDM1_46t00012; T15M6.14; T16L24.270; T18I24.5; T20K12.230; T28P6.8; VITISV_000081; VITISV_001281; VITISV_001383; VITISV_001479; VITISV_001707; VITISV_003097; VITISV_006839; VITISV

Source	GOs	Term	Type	Identity
Sma3	phosphopyruvate hydratase complex	GO:0000015	Cellular Component	-
Sma3	nuclear pore	GO:0005643	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	dihydrofolate reductase activity	GO:0004146	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	endonuclease activity	GO:0004519	Molecular Function	-
Sma3	phosphopyruvate hydratase activity	GO:0004634	Molecular Function	-
Sma3	ionotropic glutamate receptor activity	GO:0004970	Molecular Function	-
Sma3	extracellular-glutamate-gated ion channel activity	GO:0005234	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	O-methyltransferase activity	GO:0008171	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	protein transporter activity	GO:0008565	Molecular Function	-
Sma3	NADP binding	GO:0050661	Molecular Function	-
Sma3	protein import into nucleus, docking	GO:0000059	Biological Process	-
Sma3	glycolysis	GO:0006096	Biological Process	-
Sma3	glycine biosynthetic process	GO:0006545	Biological Process	-
Sma3	nucleotide biosynthetic process	GO:0009165	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	transposition	GO:0032196	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Enolase	IPR000941	-	-
Sma3	Ionotropic glutamate receptor	IPR001320	-	-
Sma3	Importin-beta, N-terminal	IPR001494	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Dihydrofolate reductase domain	IPR001796	-	-
Sma3	Pleckstrin homology domain	IPR001849	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	DNA methylase, N-6 adenine-specific, conserved site	IPR002052	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	O-methyltransferase, family 3	IPR002935	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	CS-like domain	IPR007052	-	-
Sma3	Armadillo-like helical	IPR011989	-	-
Sma3	Dihydrofolate reductase	IPR012259	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	Exportin-1/Importin-beta-like	IPR013598	-	-
Sma3	CRM1 C-terminal domain	IPR014877	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3	CS domain	IPR017447	-	-
Sma3	Peptidase A2A, retrovirus RVP subgroup	IPR018061	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LKX7

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 194 aas, your sequence is shorter than subject: 79 - 407

Fln protein: EILDLIHSEVFGPMFPKSLGGHLYYVTFIDDHSRKTWVYLMKSKDEVFVKFQEFKVEVENLIERRIKILRFDNGGEYT*

Protein Length: 80

Fln nts: AAGAAATTTTGGACCTCATTCATTCCGAAGTTTTTGGTCCTATGTTTCCAAAGTCTCTTGGTGGTCATCTCTACTATGTAACATTCATTGATGACCATTCAAGGAAAACTTGGGTTTACTTGATGAAATCCAAGGATGAAGTATTCGTTAAATTTCAAGAATTCAAAGTTGAAGTGGAGAACCTTATAGAAAGGAGAATAAAGATATTGAGGTTTGATAATGGAGGTGAATATACTTAAAAGGAAATT

Fln Alignment:

GFIJCBT03GXHDY___LDLIHSEVFGPMFPKSLGGHLYYVTFIDDHSRKTWVYLMKSXXXXXXXXXXXXXXXXNLIERRIKILRFDNGGEYT*KE
B8LKX7_______________LHLVHSDLMGPLEHPSISGSRYVLTFIDDYSRRIWVYFLKNKDEVFEKFKEFKAFVEKQSGKSIKILRTDNGKEYVNKE

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain