|
||||||
|
UniGene Name: sp_v3.0_unigene74259
Length: 231 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene74259
T |
|
Ace file of the UniGene sp_v3.0_unigene74259 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | dynamin-like protein [Arabidopsis thaliana] | - | - | 7.0e-13 | 79% |
| FL-Next | Isoform 2 of Dynamin-related protein 3B OS=Arabidopsis thaliana GN=DRP3B | - | - | 0.0 | 79% |
| Sma3 | Dynamin, putative | - | - | 3.179e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | ADL2; ADL2A; ADL2B; At2g14120; At4g33650; B1793G04.8-1; DRP3A; DRP3B; GSVIVT00001878001; GSVIVT00032811001; MICPUCDRAFT_36259; MICPUN_107250; MtrDRAFT_AC148971g33v2; OSJNBa0072D21.2; OSTLU_29011; Os01g0920400; Os04g0381000; OsI_04962; OsI_15615; OsJ_04571 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | motor activity | GO:0003774 | Molecular Function | 0.0 | - |
| Sma3 | GTPase activity | GO:0003924 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | phosphatidylinositol binding | GO:0035091 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
| Sma3 | peroxisome fission | GO:0016559 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Dynamin central domain | IPR000375 | - | 0.0 | - |
| Sma3 | G-patch domain | IPR000467 | - | 0.0 | - |
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Dynamin, GTPase domain | IPR001401 | - | 0.0 | - |
| Sma3 | Dynamin GTPase effector | IPR003130 | - | 0.0 | - |
| Sma3 | Dynamin, GTPase region, conserved site | IPR019762 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G14120.3 | - | 4.0e-17 | 79% |
| RefSeq | Arabidopsis thaliana | NP_565362.1 | dynamin-related protein 3B [Arabidopsis thaliana] | 5.0e-17 | 79% |
| RefSeq | Populus trichocarpa | XP_002309855.1 | predicted protein [Populus trichocarpa] | 6.0e-18 | 83% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8LFT2-2
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 93 aas, your sequence is shorter than subject: 76 - 370
Fln protein:
I
Protein Length:
77
Fln nts:
T
Fln Alignment:
GFIJCBT03FS58T___ITKLDIMDRGTDARNFLLGNVVPLRLGYIGIVNRSQEDIIANK
Q8LFT2-2_____________ITKLDIMDRGTDARNHLLGKTIPLRLGYVGVVNRSQEDILMNR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
