|
||||||
|
UniGene Name: sp_v3.0_unigene74071
Length: 205 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene74071
G |
|
Ace file of the UniGene sp_v3.0_unigene74071
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ribulose-phosphate 3-epimerase n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CEL2_ASPTN | - | - | 7.0e-28 | 94% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
| Sma3 | Ribulose-phosphate 3-epimerase | - | - | 1.367e-11 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribulose-phosphate 3-epimerase. | EC:5.1.3.1 | - | 6.701e-14 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pentose phosphate pathway | 00030 | 6.701e-14 | % | |
| Sma3 | Pentose and glucuronate interconversions | 00040 | 6.701e-14 | % | |
| Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 6.701e-14 | % | |
| Sma3 | Metabolic pathways | 01100 | 6.701e-14 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 6.701e-14 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g63290; At3g01850; CHLREDRAFT_6964; F28J7.18; F9N12.9; Fushion gene; GSVIVT00020537001; LOC_Os09g32810; MICPUCDRAFT_57366; MICPUCDRAFT_58794; MICPUN_80507; OSTLU_17265; OSTLU_41053; Os09g0505700; OsI_31954; OsJ_29932; Ot06g01930; Ot11g00840; PHATRDRAFT |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | ribulose-phosphate 3-epimerase activity | GO:0004750 | Molecular Function | 0.0 | - |
| Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
| Sma3 | phosphotransferase activity, alcohol group as acceptor | GO:0016773 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribulose-phosphate 3-epimerase | IPR000056 | - | 0.0 | - |
| Sma3 | Carbohydrate kinase, FGGY | IPR000577 | - | 0.0 | - |
| Sma3 | Protein of unknown function DUF775 | IPR008493 | - | 0.0 | - |
| Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
| Sma3 | Carbohydrate kinase, FGGY, conserved site | IPR018483 | - | 0.0 | - |
| Sma3 | Carbohydrate kinase, FGGY, N-terminal | IPR018484 | - | 0.0 | - |
| Sma3 | Carbohydrate kinase, FGGY, C-terminal | IPR018485 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G63290.1 | Aldolase-type TIM barrel family protein chr1:23472095-23473590 REVERSE LENGTH=227 | 2.0e-23 | 68% |
| RefSeq | Arabidopsis thaliana | NP_176518.1 | putative D-ribulose-5-phosphate 3-epimerase [Arabidopsis thaliana] | 2.0e-23 | 68% |
| RefSeq | Populus trichocarpa | XP_002300099.1 | predicted protein [Populus trichocarpa] | 1.0e-22 | 65% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NPW1
Fln msg: STOP codon was not found. Distance to subject end: 15 aas, your sequence is shorter than subject: 67 - 196
Fln protein:
F
Protein Length:
68
Fln nts:
G
Fln Alignment:
GFIJCBT03F53JA___FGGQKFMASELPKVSALRARYPELNIEVDGGLGLGTIDQAAEAGANVIVAGSAIFGAQDPADVIAKL
A9NPW1_______________FGGQKFMPDTMDKVRDLRQKYPSLDIEVDGGLGPSTIDQASSAGANCIVAGSSVFGAKDPPAVIAML
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
