|
||||||
|
UniGene Name: sp_v3.0_unigene73908
Length: 191 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene73908
G |
|
Ace file of the UniGene sp_v3.0_unigene73908 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | 3-ketoacyl-CoA synthase n=1 Tax=Picea sitchensis RepID=A9NVH1_PICSI | - | - | 9.0e-16 | 74% |
| FL-Next | sp=3-ketoacyl-CoA synthase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
| Sma3 | Fiddlehead-like protein | - | - | 2.859e-15 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transferases, Acyltransferases, Transferring groups other than amino-acyl groups. | EC:2.3.1.- | - | 7.943e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g04220; At1g68530; At2g26250; CER6; CUT1; EL4; EL6; F20D22.1; FDH; Fdh; GSVIVT00014607001; GSVIVT00016830001; GSVIVT00030335001; GSVIVT00032309001; GSVIVT00032565001; GSVIVT00036377001; GSVIVT00038212001; KCS10; KCS17; KCS6; LOC_Os03g08360; OJ1268_B08. |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | GO:0008415 | Molecular Function | 0.0 | - | |
| Sma3 | fatty acid elongase activity | GO:0009922 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity, transferring acyl groups other than amino-acyl groups | GO:0016747 | Molecular Function | 0.0 | - |
| Sma3 | fatty acid biosynthetic process | GO:0006633 | Biological Process | 0.0 | - |
| Sma3 | response to osmotic stress | GO:0006970 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to light stimulus | GO:0009416 | Biological Process | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
| Sma3 | wax biosynthetic process | GO:0010025 | Biological Process | 0.0 | - |
| Sma3 | suberin biosynthetic process | GO:0010345 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Chalcone/stilbene synthase, C-terminal | IPR012328 | - | 0.0 | - |
| Sma3 | Very-long-chain 3-ketoacyl-CoA synthase | IPR012392 | - | 0.0 | - |
| Sma3 | FAE1/Type III polyketide synthase-like protein | IPR013601 | - | 0.0 | - |
| Sma3 | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal | IPR013747 | - | 0.0 | - |
| Sma3 | Thiolase-like, subgroup | IPR016038 | - | 0.0 | - |
| Sma3 | Ribosomal protein S10, conserved site | IPR018268 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G26250.1 | FDH, KCS10 3-ketoacyl-CoA synthase 10 chr2:11170799-11173059 REVERSE LENGTH=550 | 3.0e-12 | 66% |
| RefSeq | Arabidopsis thaliana | NP_180193.1 | 3-ketoacyl-CoA synthase 10 [Arabidopsis thaliana] | 4.0e-12 | 66% |
| RefSeq | Populus trichocarpa | XP_002309451.1 | beta-ketoacyl-coa synthase family protein [Populus trichocarpa] | 2.0e-13 | 67% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVH1
Fln msg: Distance to subject end: 130 aas, your sequence is shorter than subject: 63 - 530
Fln protein:
D
Protein Length:
64
Fln nts:
G
Fln Alignment:
GFIJCBT03GMWYW___DDRSFRCVYQQEDDKRKKGLSVSRDLLEIGGHALKSGMXXXXXXXXXXXXLSEQLLFLATLIG
A9NVH1_______________DDRSFRCVYQQEDDKRKKGLSVSKDLLEIGGHALKANI---TTLGPLVLPLSEQLLFLATLIG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
