UniGene Name: sp_v3.0_unigene73905
Length: 173 nt
![]() |
---|
>sp_v3.0_unigene73905
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Serine/threonine-protein kinase-transforming protein raf, putative n=1 Tax=Ricinus communis RepID=B9RQB2_RICCO | - | - | 1.0e-10 | 82% |
FL-Next | tr=Clavata-like receptor; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 69% |
Sma3 | Leucine-rich repeat receptor-like protein kinase | - | - | 3.727e-28 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | EC:2.7.11.3- | - | 1.713e-14 | - |
Source | Gene names |
---|---|
Sma3 | AT1G05700; AT1G07550; AT1G51800; AT1G51810; AT1G51820; AT1G51860; AT1G51880; AT1G67720; AT2G19190; AT2G28960; AT2G28990; AT3G21340; AT4G29180; AT4G29450; AT4g29180; AT4g29990; AT5G59650; AT5G59670; At1g51800; At1g51800/F19C24_3; At1g51810; At2g04300; At2g |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G59670.1 | Leucine-rich repeat protein kinase family protein chr5:24041538-24045478 FORWARD LENGTH=868 | 1.0e-15 | 72% |
RefSeq | Arabidopsis thaliana | NP_200775.2 | Receptor-like protein kinase [Arabidopsis thaliana] | 2.0e-15 | 72% |
RefSeq | Populus trichocarpa | XP_002338172.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-14 | 65% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q19AV8
Fln msg: Distance to subject end: 166 aas, your sequence is shorter than subject: 57 - 998
Fln protein:
L
Protein Length:
58
Fln nts:
C
Fln Alignment:
GFIJCBT03G7MTT___SQLTWKIRLKITLDAAQGLEYLHLGCTPKIIHRDVKTANILL
Q19AV8_______________SVLDWPIRYKIALGAAQGLAYLHHGCVPAIVHRDVKSNNILL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain