|
||||||
|
UniGene Name: sp_v3.0_unigene73811
Length: 241 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene73811
A |
|
Ace file of the UniGene sp_v3.0_unigene73811 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana] gb|AAD03425.1| contains similarity to Iron/Ascorbate family of oxidoreductases (Pfam: PF00671, Score=297.8, E=1.3e-85, N=1) [Arabidopsis thaliana] emb|CAB40043.1| putative Fe(II)/a | - | - | 2.0e-26 | 67% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 81% |
| Sma3 | Flavonol synthase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonol synthase. | EC:1.14.11.23 | - | 1.72e-29 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid biosynthesis | 00941 | 1.72e-29 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.72e-29 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.72e-29 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.72e-29 | % | |
| Sma3 | Flavanone 3-dioxygenase. | EC:1.14.11.9 | - | 3.839e-23 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid biosynthesis | 00941 | 3.839e-23 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 3.839e-23 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.839e-23 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.839e-23 | % | |
| Sma3 | Aminocyclopropanecarboxylate oxidase. | EC:1.14.17.4 | - | 3.674e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cysteine and methionine metabolism | 00270 | 3.674e-07 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 3.674e-07 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.674e-07 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.674e-07 | % |
| Source | Gene names |
|---|---|
| Sma3 | 20ox; ACO; ACO1; ACO2; ANS; AT4g10490; AT4g10500; AT4g25310; At1g05010; At1g17020; At1g78550; At2g36690; At3g21420; At4g10490; At4g10500; At4g25310; At5g05600; At5g24530; At5g43450; BA-ACO; C20ox2; Cs-ACO1; DIOX; EAT1; EgFLS; F20D23.28; F20D23.29; F24A6.1 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | 1-aminocyclopropane-1-carboxylate oxidase activity | GO:0009815 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | GO:0016702 | Molecular Function | 0.0 | - |
| Sma3 | L-ascorbic acid binding | GO:0031418 | Molecular Function | 0.0 | - |
| Sma3 | flavonol synthase activity | GO:0045431 | Molecular Function | 0.0 | - |
| Sma3 | naringenin 3-dioxygenase activity | GO:0045486 | Molecular Function | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | response to fungus | GO:0009620 | Biological Process | 0.0 | - |
| Sma3 | ethylene biosynthetic process | GO:0009693 | Biological Process | 0.0 | - |
| Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
| Sma3 | fruit ripening | GO:0009835 | Biological Process | 0.0 | - |
| Sma3 | organ senescence | GO:0010260 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
| Sma3 | Isopenicillin N synthase | IPR002283 | - | 0.0 | - |
| Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
| Sma3 | Oxoglutarate/iron-dependent oxygenase | IPR005123 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 1, active site | IPR018120 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G10500.1 | 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein chr4:6491089-6492342 FORWARD LENGTH=349 | 7.0e-34 | 67% |
| RefSeq | Arabidopsis thaliana | NP_192788.1 | oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana] | 9.0e-34 | 67% |
| RefSeq | Populus trichocarpa | XP_002300519.1 | predicted protein [Populus trichocarpa] | 8.0e-34 | 63% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P1C4
Fln msg: Distance to subject end: 76 aas, your sequence is shorter than subject: 80 - 363
Fln protein:
T
Protein Length:
81
Fln nts:
A
Fln Alignment:
GFIJCBT03F7QUV___TQFMLINYYPPCPNPDLTLGVAGHSDPGGITVLMQGGVSGLQVLKDGKWVAVEPIPNAFVVNLGDQLQVVSNGRFRSVLH
A9P1C4_______________SQLMDIMYYPPCPNPDITLGTPRHSDARGITVLMQGNVSGLQVLRNGKWVAVEPIPNAFVVNMGDQLQVVSNGRFRSVEH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
