UniGene Name: sp_v3.0_unigene73455
Length: 122 nt
![]() |
---|
>sp_v3.0_unigene73455
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Inorganic diphosphatase, H+-translocating, vacuolar membrane n=15 Tax=Poaceae RepID=Q67WN5_ORYSJ | - | - | 7.0e-08 | 83% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
Sma3 | H+-pyrophosphatase | - | - | 9.849e-15 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Inorganic diphosphatase. | EC:3.6.1.1 | - | 9.689e-13 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Oxidative phosphorylation | 00190 | 9.689e-13 | % |
Source | Gene names |
---|---|
Sma3 | AVP1; At1g15690; CPP1; CVP1; GSVIVT00003288001; GSVIVT00003295001; GSVIVT00006405001; GSVIVT00022618001; HVP1; OJ1572_F02.11; OSJNBa0032L17.38; OSJNBa0035I03.12; OVP1; OVP2; OVP3; OVP5; Os01g0337500; Os02g0184200; Os02g0802500; Os06g0178900; Os06g0644200; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type vacuole membrane | GO:0009705 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | endosome membrane | GO:0010008 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | inorganic diphosphatase activity | GO:0004427 | Molecular Function | 0.0 | - |
Sma3 | hydrogen-translocating pyrophosphatase activity | GO:0009678 | Molecular Function | 0.0 | - |
Sma3 | hydrogen ion transmembrane transporter activity | GO:0015078 | Molecular Function | 0.0 | - |
Sma3 | proton transport | GO:0015992 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | RNA helicase, ATP-dependent, DEAD-box, conserved site | IPR000629 | - | 0.0 | - |
Sma3 | Prephenate dehydrogenase | IPR003099 | - | 0.0 | - |
Sma3 | Pyrophosphate-energised proton pump | IPR004131 | - | 0.0 | - |
Sma3 | NADP oxidoreductase, coenzyme F420-dependent | IPR004455 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G15690.1 | " AVP1, ATAVP3, AVP-3, AtVHP1;1 Inorganic H pyrophosphatase family protein chr1:5399115-5402185 FORWARD LENGTH=770" | 4.0e-11 | 77% |
RefSeq | Arabidopsis thaliana | NP_001077542.1 | Pyrophosphate-energized vacuolar membrane proton pump 1 [Arabidopsis thaliana] | 5.0e-11 | 77% |
RefSeq | Populus trichocarpa | XP_002330249.1 | vacuolar H+-translocating inorganic pyrophosphatase [Populus trichocarpa] | 9.0e-13 | 86% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQU4
Fln msg: Distance to subject end: 164 aas, your sequence is shorter than subject: 40 - 765
Fln protein:
C
Protein Length:
41
Fln nts:
G
Fln Alignment:
GFIJCBT03FXETQ___TFIVLTPK*FIGLIVGRMLPYWFSAMTMKVVGSAA
B8LQU4_______________TVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain