|
||||||
|
UniGene Name: sp_v3.0_unigene73446
Length: 206 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene73446
C |
|
Ace file of the UniGene sp_v3.0_unigene73446
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY n=1 Tax=Arabidopsis thaliana RepID=F4J7C7_ARATH | - | - | 4.0e-18 | 72% |
| FL-Next | sp=Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 72% |
| Sma3 | Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY | - | - | 1.67e-24 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 2.356e-14 | - |
| Source | Gene names |
|---|---|
| Sma3 | At3g11540; F24K9.29; GSVIVT00021566001; Os08g0559300; OsI_30264; OsJ_28275; PHYPADRAFT_151814; PHYPADRAFT_200715; POPTRDRAFT_1103631; POPTRDRAFT_867143; RCOM_1259290; SPY; VITISV_025331; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | protein N-acetylglucosaminyltransferase activity | GO:0016262 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity, transferring glycosyl groups | GO:0016757 | Molecular Function | 0.0 | - |
| Sma3 | cytokinin mediated signaling pathway | GO:0009736 | Biological Process | 0.0 | - |
| Sma3 | gibberellic acid mediated signaling pathway | GO:0009740 | Biological Process | 0.0 | - |
| Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of gibberellic acid mediated signaling pathway | GO:0009938 | Biological Process | 0.0 | - |
| Sma3 | cell differentiation | GO:0030154 | Biological Process | 0.0 | - |
| Sma3 | rhythmic process | GO:0048511 | Biological Process | 0.0 | - |
| Sma3 | regulation of oxygen and reactive oxygen species metabolic process | GO:0080010 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tetratricopeptide TPR-1 | IPR001440 | - | 0.0 | - |
| Sma3 | Sel1-like | IPR006597 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Tetratricopeptide repeat-containing domain | IPR013026 | - | 0.0 | - |
| Sma3 | Tetratricopeptide repeat | IPR019734 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G11540.1 | SPY Tetratricopeptide repeat (TPR)-like superfamily protein chr3:3632842-3637547 FORWARD LENGTH=914 | 2.0e-23 | 72% |
| RefSeq | Arabidopsis thaliana | NP_974286.1 | putative UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY [Arabidopsis thaliana] | 2.0e-23 | 72% |
| RefSeq | Populus trichocarpa | XP_002308458.1 | predicted protein [Populus trichocarpa] | 4.0e-23 | 71% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q96301
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 797 aas, your sequence is shorter than subject: 68 - 914
Fln protein:
S
Protein Length:
69
Fln nts:
C
Fln Alignment:
GG46A6U02HBUUY___NKFADALGLYETVLETEPTNVEAHIGKGICLQMQSAIPKAFECFAEAIALDPQNACALTHC
Q96301_______________NKFADALALYEAMLEKDSKNVEAHIGKGICLQTQNKGNLAFDCFSEAIRLDPHNACALTHC
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
