UniGene Name: sp_v3.0_unigene73311
Length: 223 nt
UniGene Fasta |
---|
>sp_v3.0_unigene73311
C |
Ace file of the UniGene sp_v3.0_unigene73311 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative mitochondrial processing peptidase alpha subunit [Oryza sativa Japonica Group] dbj|BAG89683.1| unnamed protein product [Oryza sativa Japonica Group] | - | - | 3.0e-17 | 73% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
Sma3 | Mitochondrial processing peptidase alpha subunit, putative | - | - | 1.55e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Mitochondrial processing peptidase. | EC:3.4.24.64 | - | 3.737e-17 | - |
Source | Gene names |
---|---|
Sma3 | At1g51980; At3g16480; F5F19.4; GSVIVT00016635001; GSVIVT00034277001; MDC8.11; MICPUN_91773; MPP; OSJNBa0075A10.17; Os01g0191500; Os01g0739000; Os05g0524300; OsI_00727; OsI_03671; OsJ_00704; OsJ_03392; OsJ_19261; P0638D12.13; P0710E05.34; PHYPADRAFT_114884 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrial outer membrane | GO:0005741 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial inner membrane | GO:0005743 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial respiratory chain complex III | GO:0005750 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial intermembrane space | GO:0005758 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial matrix | GO:0005759 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
Sma3 | metalloendopeptidase activity | GO:0004222 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ubiquinol-cytochrome-c reductase activity | GO:0008121 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | electron transport chain | GO:0022900 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase M16, zinc-binding site | IPR001431 | - | 0.0 | - |
Sma3 | Peptidase M16, C-terminal | IPR007863 | - | 0.0 | - |
Sma3 | Peptidase M16, core | IPR011237 | - | 0.0 | - |
Sma3 | Peptidase M16, N-terminal | IPR011765 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G16480.1 | MPPalpha mitochondrial processing peptidase alpha subunit chr3:5599906-5602716 FORWARD LENGTH=499 | 9.0e-22 | 70% |
RefSeq | Arabidopsis thaliana | NP_566548.1 | mitochondrial processing peptidase [Arabidopsis thaliana] | 1.0e-21 | 70% |
RefSeq | Populus trichocarpa | XP_002311862.1 | predicted protein [Populus trichocarpa] | 2.0e-23 | 76% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ACF4
Fln msg: Unexpected stop codon in the beginning of your sequence, Unexpected STOP codon at 3' end. Distance to subject end: 304 aas, your sequence is shorter than subject: 63 - 510
Fln protein:
S
Protein Length:
64
Fln nts:
C
Fln Alignment:
GG46A6U02FSJ79___NLRMVREVEAIGGNVTASASREQMGYTFDALKTYLPEMVELLIDSVRNAVFLTGS*R-QLVKVKSEI
D5ACF4_______________HLRMVREVEAIGGNVTASASREQMGYTFDALKTYLPEMVELLVDSVRNPVFLDWEVKEQLAKVKSEI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain