UniGene Name: sp_v3.0_unigene73310
Length: 232 nt
UniGene Fasta |
---|
>sp_v3.0_unigene73310
C |
Ace file of the UniGene sp_v3.0_unigene73310 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 n=7 Tax=Camelineae RepID=BAME2_ARATH | - | - | 7.0e-20 | 68% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 38% |
Sma3 | Receptor protein kinase like protein | - | - | 3.89e-07 | - |
Source | Gene names |
---|---|
Sma3 | AT3G49670; AT4G20270; AT4g20270; AT5G65700; At3g49670; At4g20270; At5g65700; F1C12.190; F6H11.170; GSVIVT00010645001; GSVIVT00021105001; GSVIVT00035385001; LOC_Os03g12730; LOC_Os03g56270; LRK1; LRR-RLK; MtrDRAFT_AC140550g38v2; OJ1118_D07.29; OJ1203D03.4; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | regulation of meristem structural organization | GO:0009934 | Biological Process | 0.0 | - |
Sma3 | regulation of meristem growth | GO:0010075 | Biological Process | 0.0 | - |
Sma3 | microsporocyte differentiation | GO:0010480 | Biological Process | 0.0 | - |
Sma3 | gametophyte development | GO:0048229 | Biological Process | 0.0 | - |
Sma3 | floral organ development | GO:0048437 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Enolpyruvate transferase domain | IPR001986 | - | 0.0 | - |
Sma3 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR004838 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G49670.1 | BAM2 Leucine-rich receptor-like protein kinase family protein chr3:18417741-18420836 FORWARD LENGTH=1002 | 2.0e-25 | 68% |
RefSeq | Arabidopsis thaliana | NP_190536.1 | receptor-like kinase BAM2 [Arabidopsis thaliana] | 3.0e-25 | 68% |
RefSeq | Populus trichocarpa | XP_002310320.1 | predicted protein [Populus trichocarpa] | 9.0e-25 | 68% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LS28
Fln msg: Distance to subject end: 297 aas, your sequence is shorter than subject: 77 - 610
Fln protein:
R
Protein Length:
78
Fln nts:
C
Fln Alignment:
GG46A6U02GVDAG___RDLGCHSKLLSYIDLSRNNLSGPIPSTITNLGILNYLNISRNHFSGSIPVELEQMQSLTSVDFSHNNLSGVVP
B8LS28_______________RVLGSLSRLQA-LSFTGNSLSGPIPLELGELQSLIQLNLGKNRLTGVLPTTLKNIRGLQSLDINGNILSGPIP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain