|
||||||
|
UniGene Name: sp_v3.0_unigene73302
Length: 234 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene73302
C |
|
Ace file of the UniGene sp_v3.0_unigene73302
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATP-binding cassette transporter n=2 Tax=Selaginella moellendorffii RepID=D8SFU8_SELML | - | - | 4.0e-27 | 71% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
| Sma3 | ATP-binding cassette transporter, putative | - | - | 5.037e-38 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphonate-transporting ATPase. | EC:3.6.3.28 | - | 1.896e-28 | - |
| Sma3 | Heme-transporting ATPase. | EC:3.6.3.41 | - | 2.4e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | ABC1; At1g15210; At1g15520; At1g59870; At1g66950; At2g26910; At2g29940; At2g36380; At3g16340; At3g53480; B1045F02.15; B1090H08.39; F12C20.5; F1O11.1; F1O19.3; F23F1.14; F23H11.19; F4P12.180; F9L1.15; GSVIVT00012684001; GSVIVT00016814001; GSVIVT00019709001 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | cadmium ion transmembrane transporter activity | GO:0015086 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | response to biotic stimulus | GO:0009607 | Biological Process | 0.0 | - |
| Sma3 | systemic acquired resistance | GO:0009627 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | defense response to fungus, incompatible interaction | GO:0009817 | Biological Process | 0.0 | - |
| Sma3 | response to ozone | GO:0010193 | Biological Process | 0.0 | - |
| Sma3 | cadmium ion transport | GO:0015691 | Biological Process | 0.0 | - |
| Sma3 | lead ion transport | GO:0015692 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of defense response | GO:0031348 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribosomal protein L11 | IPR000911 | - | 0.0 | - |
| Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Pleiotropic drug resistance protein PDR | IPR005285 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
| Sma3 | Plant PDR ABC transporter associated | IPR013581 | - | 0.0 | - |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G16340.1 | ATPDR1, PDR1 pleiotropic drug resistance 1 chr3:5539897-5546263 FORWARD LENGTH=1416 | 3.0e-32 | 70% |
| RefSeq | Arabidopsis thaliana | NP_001189911.1 | ABC transporter G family member 29 [Arabidopsis thaliana] | 4.0e-32 | 70% |
| RefSeq | Populus trichocarpa | XP_002303308.1 | predicted protein [Populus trichocarpa] | 5.0e-33 | 69% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NW55
Fln msg: Distance to subject end: 62 aas, your sequence is shorter than subject: 78 - 471
Fln protein:
R
Protein Length:
79
Fln nts:
C
Fln Alignment:
GG46A6U02JNS5H___CHSFLYFTYYGMLAVAITPSYQVAAVVASAFYSLFNLFSGFLIPRLALPPWWQWYYWICPTSWTLTALVTSQY
A9NW55_______________CH-FLYFTYYGMLTVAISPNAQVAAVISSAFYSIFNLFSGFLITRPQLPRWWVWYYWICPLAWTLNGLVTSQY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
