UniGene Name: sp_v3.0_unigene73286
Length: 190 nt
UniGene Fasta |
---|
>sp_v3.0_unigene73286
C |
Ace file of the UniGene sp_v3.0_unigene73286 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | glycerol-3-phosphate acyltransferase 1 [Arabidopsis thaliana] sp|Q9SHJ5.1|GPAT1_ARATH RecName: Full=Glycerol-3-phosphate acyltransferase 1; Short=AtGPAT1 gb|AAF24816.1|AC007592_9 F12K11.15 [Arabidopsis thaliana] dbj|BAF01015.1| hypothetical protein [Arabi | - | - | 1.0e-18 | 76% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 63% |
Sma3 | ER glycerol-phosphate acyltransferase | - | - | 3.491e-22 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycerol-3-phosphate O-acyltransferase. | EC:2.3.1.15 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycerolipid metabolism | 00561 | 0.0 | % | |
Sma3 | Glycerophospholipid metabolism | 00564 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | At1g01610; At1g02390; At1g06520; At2g38110; At3g11325; At3g11430; At4g00400; At4g00400/At4g00410; At4g01950; At5g06090; B1096A10.22-1; B9002; F12K11.15; F16M14.4; F22L4.15; F24K9.10; F5I10.4/F5I10.5; GPAT1; GPAT2; GPAT3; GPAT4; GPAT5; GPAT6; GPAT7; GPAT8; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | 1-acylglycerol-3-phosphate O-acyltransferase activity | GO:0003841 | Molecular Function | 0.0 | - |
Sma3 | glycerol-3-phosphate O-acyltransferase activity | GO:0004366 | Molecular Function | 0.0 | - |
Sma3 | GO:0008415 | Molecular Function | 0.0 | - | |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | phospholipid biosynthetic process | GO:0008654 | Biological Process | 0.0 | - |
Sma3 | cutin biosynthetic process | GO:0010143 | Biological Process | 0.0 | - |
Sma3 | suberin biosynthetic process | GO:0010345 | Biological Process | 0.0 | - |
Sma3 | pollen sperm cell differentiation | GO:0048235 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phospholipid/glycerol acyltransferase | IPR002123 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G06520.1 | ATGPAT1, GPAT1 glycerol-3-phosphate acyltransferase 1 chr1:1994170-1996067 REVERSE LENGTH=585 | 3.0e-24 | 76% |
RefSeq | Arabidopsis thaliana | NP_563768.1 | glycerol-3-phosphate acyltransferase 1 [Arabidopsis thaliana] | 4.0e-24 | 76% |
RefSeq | Populus trichocarpa | XP_002306740.1 | predicted protein [Populus trichocarpa] | 1.0e-24 | 80% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NXP7
Fln msg: Distance to subject end: 68 aas, your sequence is shorter than subject: 63 - 504
Fln protein:
V
Protein Length:
64
Fln nts:
C
Fln Alignment:
GG46A6U02HHA0P___VCPEGTTCREPYLLRFSPLFAEIADNIIPVAMNVTVNMFHGTTARGLKSLDPIFF
A9NXP7_______________LCPEGTTCREPFLLRYSSMFAELTDYIVPVAVNCRTSMFHGSTSRGWKAMDPFFF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain