UniGene Name: sp_v3.0_unigene73241
Length: 186 nt
UniGene Fasta |
---|
>sp_v3.0_unigene73241
C |
Ace file of the UniGene sp_v3.0_unigene73241 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative hexose transporter n=1 Tax=Manihot esculenta RepID=E7BKJ6_MANES | - | - | 3.0e-20 | 93% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
Sma3 | Sugar transporter, putative | - | - | 4.911e-36 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 4.958e-21 | - |
Source | Gene names |
---|---|
Sma3 | AGAA.1; At1g11260; At1g50310; At1g77210; At3g05960; At3g19930; At3g19940; At4g02050; At4g21480; At5g23270; At5g26250; At5g26340; At5g61520; B1008E06.22-1; B1317D11.119-1; B1317D11.119-2; F14I3.9; F18E5.100; F2O10.8; F9D12.17; F9D12.9; GSVIVT00004559001; G |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
Sma3 | sugar:hydrogen symporter activity | GO:0005351 | Molecular Function | 0.0 | - |
Sma3 | high-affinity hydrogen:glucose symporter activity | GO:0005358 | Molecular Function | 0.0 | - |
Sma3 | sucrose:hydrogen symporter activity | GO:0008506 | Molecular Function | 0.0 | - |
Sma3 | monosaccharide transmembrane transporter activity | GO:0015145 | Molecular Function | 0.0 | - |
Sma3 | substrate-specific transmembrane transporter activity | GO:0022891 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | carbohydrate transport | GO:0008643 | Biological Process | 0.0 | - |
Sma3 | sucrose transport | GO:0015770 | Biological Process | 0.0 | - |
Sma3 | carbohydrate transmembrane transport | GO:0034219 | Biological Process | 0.0 | - |
Sma3 | transmembrane transport | GO:0055085 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Sugar/inositol transporter | IPR003663 | - | 0.0 | - |
Sma3 | General substrate transporter | IPR005828 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G26340.1 | MSS1, STP13, ATSTP13 Major facilitator superfamily protein chr5:9243851-9246994 REVERSE LENGTH=526 | 6.0e-26 | 93% |
RefSeq | Arabidopsis thaliana | NP_198006.1 | sugar transport protein 13 [Arabidopsis thaliana] | 8.0e-26 | 93% |
RefSeq | Populus trichocarpa | XP_002312523.1 | predicted protein [Populus trichocarpa] | 2.0e-24 | 89% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLP1
Fln msg: Distance to subject end: 75 aas, your sequence is shorter than subject: 62 - 529
Fln protein:
R
Protein Length:
63
Fln nts:
C
Fln Alignment:
GG46A6U02ISYDC___SWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFGVAQAFLSMLCNFK
B8LLP1_______________SWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFAIAQAFLSMLCHLK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain