UniGene Name: sp_v3.0_unigene73237
Length: 207 nt
UniGene Fasta |
---|
>sp_v3.0_unigene73237
C |
Ace file of the UniGene sp_v3.0_unigene73237 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Syringolide-induced protein B13-1-1 (Fragment) n=1 Tax=Glycine max RepID=Q8S8Z5_SOYBN | - | - | 5.0e-19 | 71% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
Sma3 | L-ascorbate oxidase | - | - | 5.634e-09 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | L-ascorbate oxidase. | EC:1.10.3.3 | - | 5.14e-10 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ascorbate and aldarate metabolism | 00053 | 5.14e-10 | % | |
Sma3 | Metabolic pathways | 01100 | 5.14e-10 | % |
Source | Gene names |
---|---|
Sma3 | AAO; AO; AT4g39830; At4g39830; B13-1-1; GSVIVT00011194001; GSVIVT00017414001; GSVIVT00019442001; GSVIVT00019447001; GSVIVT00019451001; OSJNBa0062E01.2; Os06g0567200; Os06g0567900; Os09g0365900; Os09g0507300; OsI_23411; OsI_23413; OsI_31082; OsI_31967; OsJ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
Sma3 | L-ascorbate oxidase activity | GO:0008447 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Multicopper oxidase, type 1 | IPR001117 | - | 0.0 | - |
Sma3 | Multicopper oxidase, copper-binding site | IPR002355 | - | 0.0 | - |
Sma3 | Basic-leucine zipper domain | IPR004827 | - | 0.0 | - |
Sma3 | Cupredoxin | IPR008972 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 2 | IPR011706 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 3 | IPR011707 | - | 0.0 | - |
Sma3 | L-ascorbate oxidase, plants | IPR017760 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 5, conserved site | IPR018087 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G39830.1 | Cupredoxin superfamily protein chr4:18479103-18481184 FORWARD LENGTH=582 | 1.0e-21 | 61% |
RefSeq | Arabidopsis thaliana | NP_195693.1 | putative L-ascorbate oxidase [Arabidopsis thaliana] | 2.0e-21 | 61% |
RefSeq | Populus trichocarpa | XP_002309992.1 | predicted protein [Populus trichocarpa] | 1.0e-24 | 70% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A889
Fln msg: Distance to subject end: 268 aas, your sequence is shorter than subject: 68 - 573
Fln protein:
V
Protein Length:
69
Fln nts:
C
Fln Alignment:
GG46A6U02HEB1I___SLCALNFLIQGHNMTVIEADGHYVEPVSVRNLDVYSGESYSVLVRTDQDPSKNYWAAVNV
D5A889_______________SLSSLNFLIQGHKMTVVEADGHYVEPVEVENLDVYSGESYSVLIRADQDSSKNYWAAVNV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain