UniGene Name: sp_v3.0_unigene73124
Length: 190 nt
UniGene Fasta |
---|
>sp_v3.0_unigene73124
C |
Ace file of the UniGene sp_v3.0_unigene73124 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | cytochrome P450 [Arabidopsis thaliana] emb|CAB78925.1| cytochrome P450 [Arabidopsis thaliana] | - | - | 4.0e-16 | 75% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
Sma3 | ABA 8-oxidase | - | - | 5.647e-15 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | (+)-abscisic acid 8'-hydroxylase. | EC:1.14.13.93 | - | 1.369e-23 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Carotenoid biosynthesis | 00906 | 1.369e-23 | % |
Source | Gene names |
---|---|
Sma3 | ABA8OX1; ABA8OX2; ABA8OX3; At2g29090; At3g19270; At4g19230; At5g45340; CYP707A1; CYP707A10; CYP707A12v1; CYP707A13; CYP707A17; CYP707A2; CYP707A3; CYP707A4; CYP707A5; CYP707A6; CYP707A7; GSVIVT00001184001; GSVIVT00019486001; GSVIVT00024287001; GSVIVT00036 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | (+)-abscisic acid 8'-hydroxylase activity | GO:0010295 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | response to red or far red light | GO:0009639 | Biological Process | 0.0 | - |
Sma3 | abscisic acid metabolic process | GO:0009687 | Biological Process | 0.0 | - |
Sma3 | response to red light | GO:0010114 | Biological Process | 0.0 | - |
Sma3 | abscisic acid catabolic process | GO:0046345 | Biological Process | 0.0 | - |
Sma3 | release of seed from dormancy | GO:0048838 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
Sma3 | Cytochrome P450, B-class | IPR002397 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | IPR017973 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G19230.2 | - | 2.0e-21 | 75% |
RefSeq | Arabidopsis thaliana | NP_567581.1 | abscisic acid 8'-hydroxylase 1 [Arabidopsis thaliana] | 2.0e-21 | 75% |
RefSeq | Populus trichocarpa | XP_002328843.1 | predicted protein [Populus trichocarpa] | 3.0e-22 | 78% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AC99
Fln msg: Distance to subject end: 111 aas, your sequence is shorter than subject: 63 - 270
Fln protein:
V
Protein Length:
64
Fln nts:
C
Fln Alignment:
GG46A6U02GKX14___VTLAVTHIHEAKGDGCLTWADTKKMPLTSRVIQETLRIATILSFTFREAIQDVDYKGYLIPK
D5AC99_______________VTAEQEAIHEAKGEGYLTWADTKKMPLTSRVIQETLRIATILSFTFREAVQDVEYKGYLIPK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain