UniGene Name: sp_v3.0_unigene73075
Length: 111 nt
![]() |
---|
>sp_v3.0_unigene73075
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative callose synthase 1 catalytic subunit [Oryza sativa Japonica Group] | - | - | 3.0e-08 | 93% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
Sma3 | 1,3-beta-glucan synthase | - | - | 5.45e-31 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 1,3-beta-glucan synthase. | EC:2.4.1.34 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | At1g05570; At1g06490; At2g13680; At2g31960; At2g36850; At3g07160; At3g59100; At5g13000; At5g36870; CALS1; CALS10; CALS2; CALS3; CALS4; CALS5; CALS6; CALS7; CALS9; CFL1; CalS3; CalS9; F12K11.17; F13J11.3; F17J16.150; F22D22.29; F3F20.1; F5H8.14; GSL1; GSL1 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 1,3-beta-D-glucan synthase complex | GO:0000148 | Cellular Component | 0.0 | - |
Sma3 | cell plate | GO:0009504 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | 1,3-beta-D-glucan synthase activity | GO:0003843 | Molecular Function | 0.0 | - |
Sma3 | (1->3)-beta-D-glucan biosynthetic process | GO:0006075 | Biological Process | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | regulation of cell shape | GO:0008360 | Biological Process | 0.0 | - |
Sma3 | microsporogenesis | GO:0009556 | Biological Process | 0.0 | - |
Sma3 | pollen wall assembly | GO:0010208 | Biological Process | 0.0 | - |
Sma3 | developmental growth | GO:0048589 | Biological Process | 0.0 | - |
Sma3 | callose deposition in cell wall | GO:0052543 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Glycosyl transferase, family 48 | IPR003440 | - | 0.0 | - |
Sma3 | K Homology domain | IPR004087 | - | 0.0 | - |
Sma3 | K Homology domain, type 1 | IPR004088 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G06490.1 | ATGSL07, gsl07, atgsl7, GSL7 glucan synthase-like 7 chr1:1978762-1989295 FORWARD LENGTH=1958 | 7.0e-12 | 93% |
RefSeq | Arabidopsis thaliana | NP_172136.2 | callose synthase 7 [Arabidopsis thaliana] | 9.0e-12 | 93% |
RefSeq | Populus trichocarpa | XP_002307554.1 | predicted protein [Populus trichocarpa] | 9.0e-12 | 93% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AA54
Fln msg: STOP codon was not found. Distance to subject end: 12 aas, your sequence is shorter than subject: 37 - 91
Fln protein:
R
Protein Length:
38
Fln nts:
C
Fln Alignment:
GG46A6U02FRHKT___SWFPFVSEFQTRFLFNQAFSRGLQISRILA
D5AA54_______________AWFPFVSEFQTRLLFNQAFSRGLQISRILA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain