|
||||||
|
UniGene Name: sp_v3.0_unigene73043
Length: 230 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene73043
C |
|
Ace file of the UniGene sp_v3.0_unigene73043
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | OSJNBb0015G09.11 protein n=3 Tax=Oryza sativa RepID=Q7XNV5_ORYSJ | - | - | 4.0e-15 | 65% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
| Source | Gene names |
|---|---|
| Sma3 | B1047H05.26; B1047H05.29; B1047H05.53; GSVIVT00014285001; GSVIVT00029260001; GSVIVT00031303001; LOC_Os11g46960; LOC_Os11g47170; OJ1294_G12.14; OSJNBb0015G09.11; OSJNBb0035K09.33; OSJNBb0035K09.36; OSJNBb0071D01.1; Os02g0211200; Os04g0227200; Os06g0272000; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | EGF-type aspartate/asparagine hydroxylation site | IPR000152 | - | 0.0 | - |
| Sma3 | Fumarate lyase | IPR000362 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Epidermal growth factor-like domain | IPR000742 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat, typical subtype | IPR003591 | - | 0.0 | - |
| Sma3 | Epidermal growth factor-like | IPR006210 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | EGF-like calcium-binding, conserved site | IPR018097 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 1, active site | IPR018120 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G47580.1 | Leucine-rich repeat protein kinase family protein chr3:17532687-17535810 FORWARD LENGTH=1011 | 4.0e-14 | 53% |
| RefSeq | Arabidopsis thaliana | NP_190342.1 | leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] | 5.0e-14 | 53% |
| RefSeq | Populus trichocarpa | XP_002332048.1 | predicted protein, partial [Populus trichocarpa] | 4.0e-19 | 60% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NW30
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 89 aas, your sequence is shorter than subject: 76 - 247
Fln protein:
S
Protein Length:
77
Fln nts:
C
Fln Alignment:
GG46A6U02HDUWN___IAEYGLGVAISTKGDVYSYGILLLEMLTRKRPTSDMFVGDLTLHKWVDQAFPNSLKEVIDNN
A9NW30_______________LEEYGLDGHVTTKGDVYSYGIVLLEMLTGKKPTDNMFVEGMDLQKWVGNSFPNQLGEIVDNS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
