|
||||||
|
UniGene Name: sp_v3.0_unigene73023
Length: 241 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene73023
C |
|
Ace file of the UniGene sp_v3.0_unigene73023
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Beta-amylase n=1 Tax=Zea mays RepID=B6SVZ0_MAIZE | - | - | 7.0e-19 | 85% |
| FL-Next | sp=Beta-amylase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 58% |
| Sma3 | Putative beta-amylase | - | - | 2.529e-14 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Beta-amylase. | EC:3.2.1.2 | - | 4.518e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Starch and sucrose metabolism | 00500 | 4.518e-07 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.518e-07 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT4g00490; AT4g17090; At2g45880; At4g17090; F6N23.1; GSVIVT00002181001; GSVIVT00016612001; GSVIVT00026861001; GSVIVT00026862001; OJ1003_C09.20; Os09g0569200; OsI_05709; OsI_32458; OsJ_05236; OsJ_30408; POPTRDRAFT_244511; POPTRDRAFT_644451; POPTRDRAFT_6639 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | beta-amylase activity | GO:0016161 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity, transferring nitrogenous groups | GO:0016769 | Molecular Function | 0.0 | - |
| Sma3 | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | - |
| Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
| Sma3 | maltose biosynthetic process | GO:0000024 | Biological Process | 0.0 | - |
| Sma3 | polysaccharide catabolic process | GO:0000272 | Biological Process | 0.0 | - |
| Sma3 | starch catabolic process | GO:0005983 | Biological Process | 0.0 | - |
| Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycoside hydrolase, family 14B, plant | IPR001371 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 14 | IPR001554 | - | 0.0 | - |
| Sma3 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR004838 | - | 0.0 | - |
| Sma3 | Aminotransferase, class I/classII | IPR004839 | - | 0.0 | - |
| Sma3 | BZR1, transcriptional repressor | IPR008540 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 2 | IPR015422 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 14, conserved site | IPR018238 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G00490.1 | BAM2, BMY9 beta-amylase 2 chr4:222422-224862 FORWARD LENGTH=542 | 9.0e-18 | 69% |
| RefSeq | Arabidopsis thaliana | NP_191958.3 | beta-amylase 2 [Arabidopsis thaliana] | 1.0e-17 | 69% |
| RefSeq | Populus trichocarpa | XP_002320794.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-20 | 80% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVE4
Fln msg: Separated hits, possible frame ERROR between 146 and 157, Unexpected stop codon in the beginning of your sequence, Distance to subject end: 246 aas, your sequence is shorter than subject: 80 - 492
Fln protein:
S
Protein Length:
81
Fln nts:
C
Fln Alignment:
GG46A6U02G9TFA___DFMRSFRMEFNDYFEDGLISEIEIGLGPCGELRYPSYPExxxxWKYPGIGEFQ
A9NVE4_______________DFMRSFKENFTDLMGETVV-EIQVGMGPAGELRYPSYPExxxxWKFPGIGAFQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
