SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene72992

Length: 294 nt

UniGene Fasta

>sp_v3.0_unigene72992
TATATTGTAGAAAATGGTTTTCGTGACGAGGGCAGCCAACTCATGGTTCTGAATTACTATCCTGCTTGTCCCGAACCCGAGCTTACCTTAGGCATACCACCGCATTCAGATTATGGCTGCATTACCATTCTTTCCCAGGATTCTGTTGGACGGTTTCAGTTACTGCACGATGGCCAATGGAAGGCAGTACGACCATTGCCCAACTCCTTCATGGTAAACGTCGGTGATCACATAGAGGTTCTGAGCAATGGAAGATTCAAGAGCGTGGTGCATCGAGCAGTGGTGAACTCAGAG

Ace file of the UniGene sp_v3.0_unigene72992

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	pfam03171, 2OG-FeII_Oxy, 2OG-Fe(II) oxygenase superfamily	-	-	6.0e-26	48%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	59%
Sma3	Gibberellin 20-oxidase	-	-	5.78e-36	-

Source	ECs	Term	Type	e value	Identity
Sma3	Oxidoreductases, Acting on paired donors, with incorporation or reduction of molecular oxygen, With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.	EC:1.14.11.-	-	4.259e-07	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Glycine, serine and threonine metabolism	00260		4.259e-07	%
Sma3	Benzoxazinoid biosynthesis	00402		4.259e-07	%
Sma3	Diterpenoid biosynthesis	00904		4.259e-07	%
Sma3	Gibberellin 3-beta-dioxygenase.	EC:1.14.11.15	-	5.053e-07	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Diterpenoid biosynthesis	00904		5.053e-07	%
Sma3	Biosynthesis of terpenoids and steroids	01062		5.053e-07	%
Sma3	Biosynthesis of plant hormones	01070		5.053e-07	%
Sma3	Metabolic pathways	01100		5.053e-07	%
Sma3	Biosynthesis of secondary metabolites	01110		5.053e-07	%
Sma3	Flavonol synthase.	EC:1.14.11.23	-	3.003e-11	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Flavonoid biosynthesis	00941		3.003e-11	%
Sma3	Biosynthesis of phenylpropanoids	01061		3.003e-11	%
Sma3	Metabolic pathways	01100		3.003e-11	%
Sma3	Biosynthesis of secondary metabolites	01110		3.003e-11	%
Sma3	Flavanone 3-dioxygenase.	EC:1.14.11.9	-	1.427e-23	-

Source	KEGGs	Term	e value	Identity
Sma3	Flavonoid biosynthesis	00941	1.427e-23	%
Sma3	Biosynthesis of phenylpropanoids	01061	1.427e-23	%
Sma3	Metabolic pathways	01100	1.427e-23	%
Sma3	Biosynthesis of secondary metabolites	01110	1.427e-23	%

Source	Gene names
Sma3	20ox; 20ox1; 20ox2; ANS; AT4g10490; AT4g10500; AT4g25310; At2301; At2353; At2g36690; At3g21420; At3g60290; At4g10490; At4g10500; At4g25310; At4g25420; At5g24530; At5g51810; B1331F11.1; C20ox2; CmGA20ox1; CmGA20ox2; Dc20ox2; DgGA20ox; F24A6.150; F27H5_80;

Source	GOs	Term	Type	Identity
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	GO:0016702	Molecular Function	-
Sma3	gibberellin 3-beta-dioxygenase activity	GO:0016707	Molecular Function	-
Sma3	L-ascorbic acid binding	GO:0031418	Molecular Function	-
Sma3	naringenin 3-dioxygenase activity	GO:0045486	Molecular Function	-
Sma3	gibberellin 20-oxidase activity	GO:0045544	Molecular Function	-
Sma3	response to red or far red light	GO:0009639	Biological Process	-
Sma3	gibberellin metabolic process	GO:0009685	Biological Process	-
Sma3	gibberellin biosynthetic process	GO:0009686	Biological Process	-
Sma3	response to gibberellin stimulus	GO:0009739	Biological Process	-
Sma3	gibberellic acid mediated signaling pathway	GO:0009740	Biological Process	-
Sma3	flavonoid biosynthetic process	GO:0009813	Biological Process	-
Sma3	unidimensional cell growth	GO:0009826	Biological Process	-
Sma3	flower development	GO:0009908	Biological Process	-
Sma3	short-day photoperiodism, flowering	GO:0048575	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Aminoacyl-tRNA synthetase, class I, conserved site	IPR001412	-	-
Sma3	Isopenicillin N synthase	IPR002283	-	-
Sma3	Lipocalin	IPR002345	-	-
Sma3	Oxoglutarate/iron-dependent oxygenase	IPR005123	-	-
Sma3	Glycoside hydrolase, family 1, active site	IPR018120	-	-
Sma3	Ribosomal protein S14, conserved site	IPR018271	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G36690.1	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein chr2:15379930-15381987 FORWARD LENGTH=366	9.0e-37	62%
RefSeq	Arabidopsis thaliana	NP_181207.2	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase-like protein [Arabidopsis thaliana]	1.0e-36	62%
RefSeq	Populus trichocarpa	XP_002334715.1	predicted protein, partial [Populus trichocarpa]	3.0e-35	56%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NQA3

Fln msg: Distance to subject end: 67 aas, your sequence is shorter than subject: 98 - 361

Fln protein: YIVENGFRDEGSQLMVLNYYPACPEPELTLGIPPHSDYGCITILSQDSVGRFQLLHDGQWKAVRPLPNSFMVNVGDHIEVLSNGRFKSVVHRAVVNSE

Protein Length: 99

Fln nts: TATATTGTAGAAAATGGTTTTCGTGACGAGGGCAGCCAACTCATGGTTCTGAATTACTATCCTGCTTGTCCCGAACCCGAGCTTACCTTAGGCATACCACCGCATTCAGATTATGGCTGCATTACCATTCTTTCCCAGGATTCTGTTGGACGGTTTCAGTTACTGCACGATGGCCAATGGAAGGCAGTACGACCATTGCCCAACTCCTTCATGGTAAACGTCGGTGATCACATAGAGGTTCTGAGCAATGGAAGATTCAAGAGCGTGGTGCATCGAGCAGTGGTGAACTCAGAG

Fln Alignment:

GG46A6U02HBU1Y___VENGFRDEGSQLMVLNYYPACPEPELTLGIPPHSDYGCITILSQDSVGRFQLLHDGQWKAVRPLPNSFMVNVGDHIEVLSNGRFKSVVHRAVVNSE
A9NQA3_______________IQTVFKD-GIQIGVLNFYPQCPEPDETMGIAPHSDHGGLTILLQNDVGGLQVRHEGRWVAVEPSPNAFVVNVSDHLEIVSNGRYKSVEHRAVVNAE

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain