UniGene Name: sp_v3.0_unigene72990
Length: 222 nt
UniGene Fasta |
---|
>sp_v3.0_unigene72990
C |
Ace file of the UniGene sp_v3.0_unigene72990 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cytochrome P450 86B1 n=2 Tax=Arabidopsis RepID=C86B1_ARATH | - | - | 1.0e-17 | 63% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 55% |
Sma3 | Cytochrome P450 | - | - | 4.097e-13 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Unspecific monooxygenase. | EC:1.14.14.1 | - | 6.938e-10 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fatty acid metabolism | 00071 | 6.938e-10 | % | |
Sma3 | Steroid hormone biosynthesis | 00140 | 6.938e-10 | % | |
Sma3 | Caffeine metabolism | 00232 | 6.938e-10 | % | |
Sma3 | Tryptophan metabolism | 00380 | 6.938e-10 | % | |
Sma3 | Arachidonic acid metabolism | 00590 | 6.938e-10 | % | |
Sma3 | Linoleic acid metabolism | 00591 | 6.938e-10 | % | |
Sma3 | Aminobenzoate degradation | 00627 | 6.938e-10 | % | |
Sma3 | Retinol metabolism | 00830 | 6.938e-10 | % | |
Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 6.938e-10 | % | |
Sma3 | Drug metabolism - cytochrome P450 | 00982 | 6.938e-10 | % | |
Sma3 | Drug metabolism - other enzymes | 00983 | 6.938e-10 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 6.938e-10 | % | |
Sma3 | Metabolic pathways | 01100 | 6.938e-10 | % |
Source | Gene names |
---|---|
Sma3 | AT4g39490; A_IG005I10.21; At1g01600; At1g01600/F22L4_10; At4g00360; At4g39490; At5g08250; At5g23190; CYP704A10; CYP86A2; CYP86A20; CYP86A21; CYP86A24; CYP86B4; CYP86B5; CYP96A17; CYP96F5; F22L4.14; F5I10.21; GSVIVT00000440001; GSVIVT00019383001; GSVIVT000 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | GO:0008393 | Molecular Function | 0.0 | - | |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | fatty acid metabolic process | GO:0006631 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | IPR017973 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G23190.1 | CYP86B1 cytochrome P450, family 86, subfamily B, polypeptide 1 chr5:7803478-7805659 REVERSE LENGTH=559 | 4.0e-23 | 63% |
RefSeq | Arabidopsis thaliana | NP_197710.1 | cytochrome P450 86B1 [Arabidopsis thaliana] | 5.0e-23 | 63% |
RefSeq | Populus trichocarpa | XP_002306380.1 | cytochrome P450 [Populus trichocarpa] | 8.0e-23 | 64% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLC1
Fln msg: Distance to subject end: 40 aas, your sequence is shorter than subject: 73 - 528
Fln protein:
V
Protein Length:
74
Fln nts:
C
Fln Alignment:
GG46A6U02HVVH6___VVTLAVTHLGRMEKIWGADCLEFKPERWISVNSDGQVMIHQESAYKFAAFNGGPRVCLGKNMAYMQMKAAAA
B8LLC1_______________VIFYIIYAMGRMESIWGNDCMEFKPERWLN---KGVFLSHP--APKFAVFNGGPRLCLGKDFAYLQMKYLAA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain