UniGene Name: sp_v3.0_unigene72938
Length: 162 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene72938
C |
Ace file of the UniGene sp_v3.0_unigene72938
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Isocitrate dehydrogenase [NADP] n=1 Tax=Picea sitchensis RepID=A9NW62_PICSI | - | - | 7.0e-20 | 93% |
| FL-Next | sp=Isocitrate dehydrogenase [NADP]; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
| Sma3 | NADP-dependent isocitrate dehydrogenase | - | - | 8.988e-18 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Isocitrate dehydrogenase (NADP(+)). | EC:1.1.1.42 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Citrate cycle (TCA cycle) | 00020 | 0.0 | % | |
| Sma3 | Glutathione metabolism | 00480 | 0.0 | % | |
| Sma3 | Carbon fixation pathways in prokaryotes | 00720 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 0.0 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g54340; At1g65930; At5g14590; CHLREDRAFT_196567; DcNADP-ICDH1; DcNADP-ICDH2; EgICDH; F20D21.16; GSVIVT00002132001; GSVIVT00020700001; GSVIVT00023479001; ICDH; ICDH-1; ICDH-2; IDH; IDH1; IDH3; Icdh; LaICDH1; LaICDH2; OJ1735_C10.15; OSIGBa0101P20.6; OSJN |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | isocitrate dehydrogenase (NAD+) activity | GO:0004449 | Molecular Function | 0.0 | - |
| Sma3 | isocitrate dehydrogenase (NADP+) activity | GO:0004450 | Molecular Function | 0.0 | - |
| Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | NAD binding | GO:0051287 | Molecular Function | 0.0 | - |
| Sma3 | glyoxylate cycle | GO:0006097 | Biological Process | 0.0 | - |
| Sma3 | tricarboxylic acid cycle | GO:0006099 | Biological Process | 0.0 | - |
| Sma3 | isocitrate metabolic process | GO:0006102 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Isocitrate/isopropylmalate dehydrogenase | IPR001804 | - | 0.0 | - |
| Sma3 | Isocitrate dehydrogenase NADP-dependent, eukaryotic-type | IPR004790 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G65930.1 | cICDH cytosolic NADP+-dependent isocitrate dehydrogenase chr1:24539088-24541861 FORWARD LENGTH=410 | 2.0e-24 | 84% |
| RefSeq | Arabidopsis thaliana | NP_176768.1 | isocitrate dehydrogenase [Arabidopsis thaliana] | 3.0e-24 | 84% |
| RefSeq | Populus trichocarpa | XP_002298528.1 | predicted protein [Populus trichocarpa] | 6.0e-25 | 84% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NW62
Fln msg: Distance to subject end: 285 aas, your sequence is shorter than subject: 54 - 490
Fln protein:
R
Protein Length:
55
Fln nts:
C
Fln Alignment:
GG46A6U02FQZ85___FGLKSMWKSPNGTIRNILNGTVFREPIMCKNIPKLIAGWKKPICIG
A9NW62_______________FGLKSMWRSPNGTIRNILNGTVFREPIMCKNIPRIIAGWKKPICIG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta