UniGene Name: sp_v3.0_unigene72846
Length: 198 nt
UniGene Fasta |
---|
>sp_v3.0_unigene72846
C |
Ace file of the UniGene sp_v3.0_unigene72846 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Aldehyde dehydrogenase (Fragment) n=1 Tax=Leymus chinensis RepID=Q1PB54_LEYCH | - | - | 1.0e-14 | 65% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
Sma3 | Aldehyde dehydrogenase | - | - | 1.353e-17 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aldehyde dehydrogenase (NAD(+)). | EC:1.2.1.3 | - | 4.973e-09 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycolysis / Gluconeogenesis | 00010 | 4.973e-09 | % | |
Sma3 | Pentose and glucuronate interconversions | 00040 | 4.973e-09 | % | |
Sma3 | Ascorbate and aldarate metabolism | 00053 | 4.973e-09 | % | |
Sma3 | Fatty acid metabolism | 00071 | 4.973e-09 | % | |
Sma3 | Valine, leucine and isoleucine degradation | 00280 | 4.973e-09 | % | |
Sma3 | Lysine degradation | 00310 | 4.973e-09 | % | |
Sma3 | Arginine and proline metabolism | 00330 | 4.973e-09 | % | |
Sma3 | Histidine metabolism | 00340 | 4.973e-09 | % | |
Sma3 | Tryptophan metabolism | 00380 | 4.973e-09 | % | |
Sma3 | beta-Alanine metabolism | 00410 | 4.973e-09 | % | |
Sma3 | Glycerolipid metabolism | 00561 | 4.973e-09 | % | |
Sma3 | Pyruvate metabolism | 00620 | 4.973e-09 | % | |
Sma3 | Chloroalkane and chloroalkene degradation | 00625 | 4.973e-09 | % | |
Sma3 | Propanoate metabolism | 00640 | 4.973e-09 | % | |
Sma3 | Limonene and pinene degradation | 00903 | 4.973e-09 | % | |
Sma3 | Metabolic pathways | 01100 | 4.973e-09 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.973e-09 | % |
Source | Gene names |
---|---|
Sma3 | ALDH; ALDH1a; ALDH2; ALDH2A; ALDH2C4; ALDH2b; Aldh; Aldh1; Aldh2b; At3g24503; GSVIVT00028844001; MOB24.3; OSJNBa0084K06.38; Os01g0591000; Os01g0591300; Os06g0270900; OsI_02651; OsI_02656; OsI_22484; OsI_23559; OsI_23564; OsJ_02429; OsJ_02431; OsJ_20928; O |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | aldehyde dehydrogenase (NAD) activity | GO:0004029 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | coniferyl-aldehyde dehydrogenase activity | GO:0050269 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | phenylpropanoid biosynthetic process | GO:0009699 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aldehyde dehydrogenase domain | IPR015590 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, N-terminal | IPR016162 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, C-terminal | IPR016163 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G24503.1 | ALDH2C4, ALDH1A, REF1 aldehyde dehydrogenase 2C4 chr3:8919732-8923029 REVERSE LENGTH=501 | 2.0e-19 | 60% |
RefSeq | Arabidopsis thaliana | NP_566749.1 | aldehyde dehydrogenase 2C4 [Arabidopsis thaliana] | 3.0e-19 | 60% |
RefSeq | Populus trichocarpa | XP_002324977.1 | predicted protein [Populus trichocarpa] | 4.0e-18 | 57% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLF5
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 103 aas, your sequence is shorter than subject: 65 - 500
Fln protein:
S
Protein Length:
66
Fln nts:
C
Fln Alignment:
GG46A6U02GU69Z___GPQIDKLQFEKVLKYIQYGKAEGANLVTGGSCLGGPGFYIETTIFSDVQDDMKIAQD
B8LLF5_______________GPQIDKMQFEKILKYIQYGKRDGANLVLGGNSLGNKGFYIEPTIFSDVEDDMQIAKE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain